PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G101000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family TCP
Protein Properties Length: 145aa    MW: 15838.1 Da    PI: 11.8713
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G101000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP65.91.4e-2038108273
                 TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                         a +kdrhsk+ T +g+RdR v l +++a++f+d+q  LG d++sk+i WL+ +ak++   + ++ +++a+ +
  Seita.2G101000.1.p  38 ARGKDRHSKVVTVRGLRDRHVQL-VPTAIQFYDIQYCLGIDQPSKAIVWLIHAAKTSTSSMLSLANTPAHTA 108
                         779********************.689******************************999999977776333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136916.7664097IPR017887Transcription factor TCP subgroup
PfamPF036342.8E-1840103IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MKEIGMERTA ASARTPRWTA ARWPPRRHGG RAGWRTAARG KDRHSKVVTV RGLRDRHVQL  60
VPTAIQFYDI QYCLGIDQPS KAIVWLIHAA KTSTSSMLSL ANTPAHTAPH LDPCAHHRSC  120
REPPAPHRHR LGGPVGESPR AGGG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.2G101000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004959137.11e-101transcription factor TCP13-like
TrEMBLA0A368PXN61e-100A0A368PXN6_SETIT; Uncharacterized protein
STRINGPavir.J37910.1.p5e-25(Panicum virgatum)
STRINGSi022811m2e-23(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5831322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18390.24e-20TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2