PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G050700.1.p
Common NameSETIT_028949mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 793aa    MW: 85455.4 Da    PI: 6.5404
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G050700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.25e-16479517240
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                          +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  Seita.2G050700.1.p 479 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 517
                         589**********************************96 PP

2TCR50.25.1e-16564603140
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  Seita.2G050700.1.p 564 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCESCKNTF 603
                         589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17478519IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.017479604IPR005172CRC domain
PfamPF036389.0E-12481516IPR005172CRC domain
SMARTSM011143.5E-16564605IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11566602IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
Sequence ? help Back to Top
Protein Sequence    Length: 793 aa     Download sequence    Send to blast
MSVRVCSGSA EERIAAPEMD TPDRAAAQPA ASRAEDSPVF SFINNLSPIE PLKSAYNANS  60
LQGYQSINIT SISSIFTSPH DNAHKEPRLP KSSLGEISES EVCADGKNTN KPTKSTNAVR  120
LFACTSTVTQ ETHTVTCSDV VDPPTVPCNL AQPAQFDNGS PDHNTTPCHG VRSDLKQDKC  180
RKLDVVQTVK STVEKRKCLF STEIQLLDGG QPVNDNNEVL GCEWSDLIAT TSGELLAFDS  240
TMDDHHRGMH LAAKNAESCG YLLSKLAGDG EISERAYPNA SGQVYYQELV MGEDQTENAQ  300
IFQDGQQTIS TEEIQDNIYE ANGCIPLDYK VESQQQRGVR RRCLVFEAAG FSNSVVQKES  360
VEDLSVSTCK GKGHVQTQPR GLRGIGLHLN ALALTPKGKM ACQDPMASAL LPSSASEKDA  420
HGKLLCAGEN FTHSGGELLE FPMDDCSSGG FPLNDHVSSQ SVSPQKKRRK TDNGDDGEAC  480
KRCSCKKSKC LKLYCECFAA GVYCSEPCSC QGCLNKPIHE EIVLSTRKQI EFRNPLAFAP  540
KVIRMSDASL ETGEDPNNTP ASARHKRGCN CKKSSCLKKY CECYQGGVGC SSNCRCESCK  600
NTFGRRDAET ELTEEMKQEG EQTENSGKEK ENDQQKANVQ SEDHPLVELV PITPPFDLSS  660
SLLKLPNFSS AKPPRPSKAR SGSSRSSASK ATTTLQSCKS SKAAGSGIDE EMPDILKEAD  720
SPSRVKTTSP NRKRVSPPHN ALSISPNRKG GRKLILKSIP SFPSLTGDSN SGSAMNNTDS  780
TFSASPLALG PS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-1548160112120Protein lin-54 homolog
5fd3_B4e-1548160112120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1465469KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.2G050700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955606.10.0protein tesmin/TSO1-like CXC 3 isoform X1
TrEMBLA0A368PV870.0A0A368PV87_SETIT; Uncharacterized protein
STRINGSi028949m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.15e-82TESMIN/TSO1-like CXC 2