PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G335800.1.p
Common NameLOC101760452, SETIT_016483mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 712aa    MW: 77892.7 Da    PI: 6.6544
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G335800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox651e-201772156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +++ +++t+ q+++Le++F+++++p++++r +L+++lgL+ rq+k+WFqNrR+++k
  Seita.1G335800.1.p 17 KKRYHRHTPRQIQQLEAMFKECPHPDENQRMQLSRELGLEPRQIKFWFQNRRTQMK 72
                        678899***********************************************998 PP

2START154.58.5e-492164442206
                         HHHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
               START   2 laeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                         +a +a++el+++a+a+e++W +         e +n d++ ++f++ ++       ++e +r+sg+v+m +  lv  ++d++ +W e ++  
  Seita.1G335800.1.p 216 MATRAMDELIRMAQAGEQLWARTGgghdggrEVLNVDTYDSIFAKPGGsfrgpdVHVEGSRDSGLVFMSAIGLVDMFMDSS-KWMEFFPgi 305
                         57899*******************8888888888888888888776669********************************.********* PP

                         ..EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECT CS
               START  78 ..kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksn 159
                           ka t++v+ +g     + l+lm+ el + sp+vp R+f f+Ry+rq + g w+i+dvSvd +       ++  R+ +lpSg+li +++n
  Seita.1G335800.1.p 306 vaKARTIDVLVNGmagrsESLVLMYEELHVTSPVVPtREFCFLRYCRQIEHGLWAIADVSVDLQPRDARfGAPPSRSCRLPSGCLIADMAN 396
                         **************************************************************8777666799999**************** PP

                         CEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 160 ghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                         g+skvtwveh++ ++r+p h l+r l+ sg+a+ga +w+a+lqr ce+
  Seita.1G335800.1.p 397 GYSKVTWVEHMEIEDRVPiHLLYRDLILSGAAFGAHRWLAALQRACER 444
                         **********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.8E-20674IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-221180IPR009057Homeodomain-like
PROSITE profilePS5007118.0581474IPR001356Homeobox domain
SMARTSM003891.4E-191578IPR001356Homeobox domain
CDDcd000861.27E-191675No hitNo description
PfamPF000463.1E-181772IPR001356Homeobox domain
PROSITE patternPS0002704972IPR017970Homeobox, conserved site
PROSITE profilePS5084844.255206447IPR002913START domain
SuperFamilySSF559612.0E-30208444No hitNo description
CDDcd088751.17E-108210443No hitNo description
SMARTSM002344.2E-37215444IPR002913START domain
PfamPF018524.4E-41216444IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-4337414IPR023393START-like domain
SuperFamilySSF559615.92E-21462694No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MDFGDDVMDG NDGQRRKKRY HRHTPRQIQQ LEAMFKECPH PDENQRMQLS RELGLEPRQI  60
KFWFQNRRTQ MKAQHERQDN CFLRAENDKI RCENIAMREA LRNVICPTCG GPPVPDDYFD  120
EQKMRMENAR LKEELDRVSS LTSKYLGRPI TQLPPVQPLS MSSLDLSVGG LGSPALGPSL  180
DLDLLSGGSS GYHHHHPSFH LPTAVPELER PIMAEMATRA MDELIRMAQA GEQLWARTGG  240
GHDGGREVLN VDTYDSIFAK PGGSFRGPDV HVEGSRDSGL VFMSAIGLVD MFMDSSKWME  300
FFPGIVAKAR TIDVLVNGMA GRSESLVLMY EELHVTSPVV PTREFCFLRY CRQIEHGLWA  360
IADVSVDLQP RDARFGAPPS RSCRLPSGCL IADMANGYSK VTWVEHMEIE DRVPIHLLYR  420
DLILSGAAFG AHRWLAALQR ACERSACLTT AGMPPRDIAG VTPEGKRSMM KLSQRMVSSF  480
CASLSSSQLH RWTMLSGPND VGVRVMVHRS TDPGQPSGVV LSAATSIWLP VPCDRVFAFV  540
RDENTRSQWD VLSHGNQVQE VSRIPNGSHP GNCISLLRGL NASQNSILIL QESCTDASGS  600
LVVYAPIDVP AANVVMSGED PSAIPLLPSG FTILPDGRHG ASSSSAGPLG SPAAGSLVTV  660
AFQILVSSLP SSKLNAESVA TVNSLISTTV EQIKAALNCA SHSWMDGSMG N*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7285230.0KJ728523.1 Zea mays clone pUT6828 HB transcription factor (HB83) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954072.10.0PREDICTED: homeobox-leucine zipper protein ROC8-like
SwissprotQ69T580.0ROC8_ORYSJ; Homeobox-leucine zipper protein ROC8
TrEMBLK3YQE00.0K3YQE0_SETIT; Uncharacterized protein
STRINGSi016483m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29123770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11