PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G273300.1.p
Common NameLOC101761523, SETIT_016627mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 637aa    MW: 66123.8 Da    PI: 9.7235
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G273300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS307.72.7e-942726362374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL e A av++g+ ++a a La l+++++p+gd+ qRl+a+++ AL++r+           ++++ +e    e+ aa +l+++vsP++ 
  Seita.1G273300.1.p 272 RQLLSETAAAVADGNRTAAAAHLAALKTTVNPRGDAEQRLVAMMAAALSSRIGP--------PSSQQLAELCGPEQRAACQLLHDVSPCFG 354
                         689**************************************************9........333333333366777899*********** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefn 179
                         ++   aN aIl+av+g++++H iDfd+s  +Q +aL+qaLasR+     l++T+v++p+s      +++l +tg+rL++ A++ g++f+fn
  Seita.1G273300.1.p 355 LALHGANLAILDAVAGQRAIHLIDFDVSV-AQHIALIQALASRRVAGTCLKVTAVADPASPftpaLTQALAATGQRLKRHAQQAGLEFRFN 444
                         ***************************96.79*************************99888998999*********************** PP

                GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         + v+ r  +++ ++L ++pgEalaVnl+++l r+ desvs +++rde+L+ v+ l P+vv +veqe+++n++++++rf++a+ +y a+++s
  Seita.1G273300.1.p 445 A-VSCRAGEIDASRLGCEPGEALAVNLAFALSRVADESVSPANPRDELLRRVRALGPRVVALVEQELNTNTAPLAARFADACAHYGAVLES 534
                         *.7999************************************************************************************* PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         l+a+l+r+s +r+  E++ l+++++n++a eg +r er+e ++kWr+r+++aG++pv++++ +a+ +k+ l +    g+ v+ +sg l  g
  Seita.1G273300.1.p 535 LDATLARDSPQRARAEEA-LANKATNALAREGPDRMERCEVFGKWRARFGMAGLRPVAIGQGIADRVKARLGHAR-PGFDVKLDSGRLGVG 623
                         ******************.99**************************************************9998.9************** PP

                GRAS 362 WkdrpLvsvSaWr 374
                         W++r ++++SaWr
  Seita.1G273300.1.p 624 WMGRVVTVASAWR 636
                         ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.871245617IPR005202Transcription factor GRAS
PfamPF035149.3E-92272636IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 637 aa     Download sequence    Send to blast
MEPAGAPWCD PRRGYGYGYG GGSVARAPGV RRQPQQPPRQ DAAAVATGGV LKRSLGEVER  60
WQQALYLRAV RQRVTAQAQA AHPPIDIGAV LARAASRSSG FSGPPSAGFA GLSPQPSSTL  120
SSLTTGSHMA TPQPQPPMQQ LLRRQMAAAP PAPPQAAQAV VARGPAARPA TAREMVLLHE  180
LEKKLLGDDD DGDAEAAGSA CGSTVTSSAW GDTMQELNSI TAASLPSLPM ASATNNYNNT  240
VPITRSPTNS ASSSTASSTA SSSPPTSAAS SRQLLSETAA AVADGNRTAA AAHLAALKTT  300
VNPRGDAEQR LVAMMAAALS SRIGPPSSQQ LAELCGPEQR AACQLLHDVS PCFGLALHGA  360
NLAILDAVAG QRAIHLIDFD VSVAQHIALI QALASRRVAG TCLKVTAVAD PASPFTPALT  420
QALAATGQRL KRHAQQAGLE FRFNAVSCRA GEIDASRLGC EPGEALAVNL AFALSRVADE  480
SVSPANPRDE LLRRVRALGP RVVALVEQEL NTNTAPLAAR FADACAHYGA VLESLDATLA  540
RDSPQRARAE EALANKATNA LAREGPDRME RCEVFGKWRA RFGMAGLRPV AIGQGIADRV  600
KARLGHARPG FDVKLDSGRL GVGWMGRVVT VASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-402676361375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9570740.0EU957074.1 Zea mays clone 1581966 chitin-inducible gibberellin-responsive protein 2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953458.10.0PREDICTED: scarecrow-like protein 8
TrEMBLK3YQT30.0K3YQT3_SETIT; Uncharacterized protein
STRINGSi016627m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.16e-97SCARECROW-like 8