PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G169900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 257aa    MW: 27851.3 Da    PI: 4.7679
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G169900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding249e-08143185346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +WT+ E+ l++ +   + g+ W++ +r+    Rt+ q+ s++qk
  Seita.1G169900.1.p 143 KWTEYEHRLFLAGLPFYRGN-WNAMSREYLMSRTASQIASHYQK 185
                         8*****************99.*********99***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015571.8E-7139186IPR006447Myb domain, plants
SuperFamilySSF466899.72E-8142185IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-6143185IPR009057Homeodomain-like
PfamPF002491.9E-5143185IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MHHDGYVAAA AAPPLALAAS PTLEPEQEPK WTRRDDKFLE LLLFNRNTIS LHIASSIIGK  60
TPAQIHQRCT FMFAELSHVL ESLEVLTPLV WDMEIAAMAA AAEEEVVPEA VVPAAPPVAA  120
RKNSAERAIG AGGAKRNKKA AEKWTEYEHR LFLAGLPFYR GNWNAMSREY LMSRTASQIA  180
SHYQKASIHD ITEPGIAAAF AVSGGEAAAW KGELPRSEAS ARGQENEPWE PIESGEDGLS  240
PVEEFPSEDD PGTLLT*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.1G169900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986850.11e-142transcription factor SRM1
TrEMBLA0A368PM010.0A0A368PM01_SETIT; Uncharacterized protein
STRINGSi039462m1e-141(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144181825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.12e-11MYB family protein