PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676792470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family TCP
Protein Properties Length: 3160aa    MW: 353046 Da    PI: 6.9634
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676792470genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP85.71.1e-2643127387
        TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsss 87 
                 +kdrhsk+ T++g+RdRRvRls ++a +f dLq++LG+d++ k++eWL+++ak +i +l+++ ++++   ++++++s++ +  s
  676792470  43 SGKDRHSKVFTSKGPRDRRVRLSGSTALQFCDLQNRLGYDQPNKAVEWLIKAAKDSISQLPSSLNITNFPITDDKNQSQTLAGAS 127
                68*************************************************************7777755533333333222111 PP

2TCP101.91.1e-311532902133
        TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg.....kaaksaa. 95 
                 g++drh k+ T++g+RdRR Rls+++a++f+dLqd+LG+d++sk++eWL+++a+ +i el+++ ++++  ++++++++++ +  s+     ++ +++a 
  676792470 153 SGGEDRHGKVFTSKGLRDRRARLSLSTAIQFYDLQDRLGYDRPSKAVEWLIKAAEDSISELPSL-NNTNFPMTDDENQNQTLTGASAaaataSSLSKSAc 251
                5789************************************************************.33333343333333333222224566655556665 PP

        TCP  96 kskksqksaasalnlak.esrakarararertrekmrik 133
                +sk+++++++s l+l++ e r ka++   ++t+e+  ++
  676792470 252 SSKSDTSKNSSGLSLSRsERRDKASEGTVKETKERDGNS 290
                777777777888999997888888888878888877666 PP

3B349.86.2e-16528637199
                EEEE-..-HHHHTT-EE--HHH.HTT.............---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.............ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                f+k lt+sd ++++ lv+  +  +               +g++e  + l++ede+g+ W++ ++y + s+ry ltkGW+++ k+++L +gDfv F+++ +
  676792470 528 FQKYLTTSDLSNLDSLVVAVDEDSGKyvrsatatatatvDGDTE--RILQVEDEEGKLWQFGFSYLNVSQRYELTKGWSNYIKEKQLGAGDFVFFQRHCT 625
                78888999999998888877653333477778888887766644..48************************************************9988 PP

                SEE..EEEEE-S CS
         B3  88 sefelvvkvfrk 99 
                ++ +l++++ r+
  676792470 626 DSSRLFIGFKRR 637
                777789888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.6E-2743122IPR005333Transcription factor, TCP
PROSITE profilePS5136926.53744102IPR017887Transcription factor TCP subgroup
PfamPF036341.6E-30155278IPR005333Transcription factor, TCP
PROSITE profilePS5136928.054155213IPR017887Transcription factor TCP subgroup
Gene3DG3DSA:2.40.330.106.2E-18522637IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.51E-13523633IPR015300DNA-binding pseudobarrel domain
CDDcd100172.75E-12527635No hitNo description
PROSITE profilePS5086311.533528638IPR003340B3 DNA binding domain
SMARTSM010195.9E-5528638IPR003340B3 DNA binding domain
PfamPF023629.0E-13528637IPR003340B3 DNA binding domain
SMARTSM002553.6E-4707847IPR000157Toll/interleukin-1 receptor homology (TIR) domain
PfamPF015824.2E-16716826IPR000157Toll/interleukin-1 receptor homology (TIR) domain
SuperFamilySSF522001.7E-11719822IPR000157Toll/interleukin-1 receptor homology (TIR) domain
SuperFamilySSF525409.77E-398671114IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF009314.1E-218751122IPR002182NB-ARC
Gene3DG3DSA:3.40.50.3006.4E-58871033IPR027417P-loop containing nucleoside triphosphate hydrolase
PRINTSPR003644.5E-19888903No hitNo description
PRINTSPR003644.5E-19964978No hitNo description
PRINTSPR003644.5E-1910551069No hitNo description
SuperFamilySSF467852.72E-610911194IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:3.40.50.3001.1E-611421193IPR027417P-loop containing nucleoside triphosphate hydrolase
SuperFamilySSF520586.8E-3112151441IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.102.1E-2312171443IPR032675Leucine-rich repeat domain, L domain-like
PfamPF077251.4E-812781297IPR011713Leucine-rich repeat 3
PRINTSPR003644.5E-1913671383No hitNo description
PROSITE profilePS5131919.32515171594IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476761.57E-1715191604IPR017923Transcription factor IIS, N-terminal
CDDcd001833.34E-1415201591No hitNo description
Gene3DG3DSA:1.20.930.103.6E-2115201591IPR017923Transcription factor IIS, N-terminal
SMARTSM005094.6E-815221593IPR003617Transcription elongation factor, TFIIS/CRSP70, N-terminal, sub-type
PfamPF087112.6E-1115421591IPR017923Transcription factor IIS, N-terminal
PROSITE profilePS5010311.73216511679IPR000571Zinc finger, CCCH-type
PfamPF079281.3E-4228993029IPR012501Vps54-likeVacuolar protein sorting-associated protein 54, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0007165Biological Processsignal transduction
GO:0042147Biological Processretrograde transport, endosome to Golgi
GO:0000139Cellular ComponentGolgi membrane
GO:0000938Cellular ComponentGARP complex
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0043531Molecular FunctionADP binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 3160 aa     Download sequence    Send to blast
MIGDLMKNNN DDVVDKNEGS NNNLLRQRHN NSSGIIKVSR ASSGKDRHSK VFTSKGPRDR  60
RVRLSGSTAL QFCDLQNRLG YDQPNKAVEW LIKAAKDSIS QLPSSLNITN FPITDDKNQS  120
QTLAGASSGT ATANSLSKSD IDSSRIIIIS RASGGEDRHG KVFTSKGLRD RRARLSLSTA  180
IQFYDLQDRL GYDRPSKAVE WLIKAAEDSI SELPSLNNTN FPMTDDENQN QTLTGASAAA  240
ATASSLSKSA CSSKSDTSKN SSGLSLSRSE RRDKASEGTV KETKERDGNS HHTTLPSFTH  300
QLVSGSGSIS SNLQWMAPSS SPSPMEYFGS GLILGLGQTH FPIQTNAHPF SSMSDHHQEF  360
SFVPDHLISP AGSKGGGALN LDFNISTTCA GVSGFNRGTL QSYSANDDRH HQSFLASLKE  420
AFCEFLRHRN PLRSFSESTV DDAIEFFRTL PSDRCNKAIS HLSKATFNET DGDHEENPFG  480
NPVVRTFLQE RVKELAHEKE YGDKKLNPEG RRPEITGRYR DDDKENLFQK YLTTSDLSNL  540
DSLVVAVDED SGKYVRSATA TATATVDGDT ERILQVEDEE GKLWQFGFSY LNVSQRYELT  600
KGWSNYIKEK QLGAGDFVFF QRHCTDSSRL FIGFKRREAA LGQWDYLRCH DLSSLATSSE  660
ALEVTPKKVE AALGLSTSSE TLELTEKPKE VETPVQLTIP EYSITGSDPI LVFYCGDNQD  720
AEERYFISYI SNELCLCGFT PLIFDLTRST VTGNLEMLHG SQIGIIIFSN NYSFSRQCLD  780
EFVAILDHWK ANNLVLLPVF FKVNVAYIRR QSGSFGDAFS RLENSVHTLI SINKYEYMKG  840
DDVIIVKSIV RDVCLLLNSE ANMNLRRSLQ MKSILTILNC SQFSGPHIVG LWGMVGIGKT  900
TIAREIFRIQ AERYDVCYYL PDFYKVCQTR GLSHLRDEFF SKISGEEKVI IDACDTKLSF  960
TRDRFLCKKV LIVLDGVIDA RDAEVLVGGF GWFSGRHTII LTSRNRQVLV QCNAKDIYEI  1020
QKLSKPESLR LFCQFATEQT LKGRTWLISE LLNYASGNPL ALRVLGSSLQ KQCINDEKLH  1080
LRSLRQHPPI EIRDAFGISF NKLDDNEKTI FLDLACFFRG ENKDRVVNIL DGCGFLTDLG  1140
IYGLIDESLI SLVDNRIEMP NIFQDTGRFI VCQENNDTCK RSRLWDPNDI VDVLTNNSGT  1200
EAIEGLFLDA SGLTFDLSPN AFEKMYRLRL LKLYYQTSKN HCKVCLPEGL YSLPDELRLL  1260
HWERYPLGSL PRNFNPKNLV ELNMPYSSLT KLWKGTKNLE KLKRIILSHS RELTKFPRLS  1320
KARNLEHIDF EGCTSLIKVN SSILYHHKLT FLSLKDCSHL RIMPTTVHLE ALEVLNLSGC  1380
SELEDIQDFS PNLKELYLAG TAIRKLPSSI GGLSRLVTLD LENCDRLLHL PPEISKLKVV  1440
VTLSGKRPVS SLDLSSVEDT APPYKRWRLK KVIETVILSL RKRKHENSVS RFNGRVHEET  1500
KEEKKVKEKL VDGDNDDRLK SILNIQKKLE DPDLSEEALI ELLQNLGYVD ITLGLLQDCD  1560
IGRRVNRLRE HRSKNVQRLA KQLIKKWKDI VAESMRLNQP GDPKPPSLVC KGKESNSESR  1620
KKHHPSQFHH PKDRETSVPV GSLNLPGLPL RPGKPVCALY FHTGNCSSGP TCIFDHPSLF  1680
PTHKNTSLVF SGTPHLNQLG FSSSIGDSSS ELVEASSKKP RIHKNASSMA SETRRLSPLG  1740
SFYSIGDSSS ELVEASTMSE ITEATVDKDT FYSSDLLSSE IVEASLLSEI TQVSGTDTIG  1800
LWDVNEEDTV FVASTFKPSS LFSSNTPEES PTVEKDHMFL FGYVIMNPVE GSDHDVQADL  1860
VSFEFHPVNA ENQLLDDRCT VKRCGVHLVT ALLEQLVIPH LVQNVQLLAW IQFILVKFDY  1920
INFEKNEGKE FGSHKFLRIK TAPSQSYSSL TDSLAAIHKS TQSAAWVYQV SRARSLEKKR  1980
TKEFGYSDRS IPRRSYSAES MKQRRSYSDD SIHDAAIGIQ TNFREYKCRK QHLITRQEIV  2040
LIQMTWIVNP PSNESSAVKT PHWSPPPPLE PSHRRLRPRE EGFLNQTLHD FDFVSDLMDS  2100
HPSLMGRSIG NSNRSSLDLG RSSSSSSSSS PSSLTKSISD ASSQSLSSIL NNPHGGKSGV  2160
YGSDASWVGW WSSSTFVAPS EFAPVASTKL PGSELTRSDF HGYVSSISES HGRFEDIRNH  2220
TKEESSGFDQ ESHVSGLAAC LREVPSLYFK EDFALEDGAT FRSACPFSSL TENLALQEKL  2280
SQYLDVVELH LVKEISVRSD SFFEAQGQLQ DLNVKIVEGC SRIRELKETI RLLDRNLVDS  2340
ARQIQELSST RINMLELQRK LRLILYVNQA LTALKLLVAS ADCAGALDIT DDLQNLLTGD  2400
ELTGLHCFRH LRDHVTTSIE SINRISPLRG RHFYRLMIMN APSILTAEFM RISIHNTGEI  2460
DVLILSAAKK RGSISSNGET GDEVKLEEDT TTLCDRLLPL VIGLLRTAKF PSILRMYREA  2520
LTSEMKNAIK NAVAELLPIL VTRSLESDFS HGERSVDVDE SMLIPSAYTG GGLSLASKLR  2580
TLSSEAFVNL LTAIFRIVQA HLVRASEVKK AIEWILCNID GHYAADSVAA AIAVGAVAAE  2640
SAQETGFQGG PLVSSPLGKA TSKAPPLQRK SSDTSSLMNL SRNFRADVLR ENTEAIFAAC  2700
EVTHARWAKL LGVRALLHPK LKLQEFMSIY DLTQEFITAT EKIGGRLGSS IRGTLQSQAK  2760
AFVDSQHEAR MTKLKAVLDQ ETWDEIDVPE EFQSIIGSLF ASKELISGKV DDADIRTHHK  2820
NPLPLNGSLT SGSGDQTTEL RNEKSESSED PAVGNAQVKS TVSPEFLERS KAGVSPVTNS  2880
QSNQKAHGKS NLFYQGVGYH MVNCGLILLK MLSEYIDMNN SLPALSSEIV LRVIEVLRFF  2940
NTRTCQLVLG AGAMQVSGLK SIKAKHLALA SQVIDFTYTI IPESRRILFS KVPETRKPLL  3000
SGEIDKVAQD YRVHRDEIYT KLVQIMRERL LAHLHGLPKV VEGWNRPPDT NKQTKEFAWP  3060
LTREVGYLHR VLSETLHEAD VQAIFRQVIL IIHTQTSQTL ANLEISSPEA KKRLKLHVEL  3120
ILKCIRSLPS DNANQSEIPN WGQLDEFFAQ NFREEGGEAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-2049214155Putative transcription factor PCF6
5zkt_B1e-2049214155Putative transcription factor PCF6
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
118791883TVKRC
Cis-element ? help Back to Top
SourceLink
PlantRegMap676792470
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM919722
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12020.11e-137WRKY family protein