PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676792224
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family GeBP
Protein Properties Length: 425aa    MW: 47804.9 Da    PI: 4.923
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676792224genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573115.92.3e-36147239298
     DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                lfqr+wseeDei+lLqG+id+ka+tg sp+dd+d+fyef +k isf++sk+q+++Kir LKkK+ +kv k   g   s++k+hd ++++l + iWgs
  676792224 147 LFQRVWSEEDEISLLQGMIDYKAETGDSPYDDMDGFYEFTRKYISFEASKNQFLDKIRYLKKKYMGKVGK---GV-ESLKKAHDIECLKLFECIWGS 239
                79********************************************************************...54.49*****************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.0E-28148238IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MATKKFNPLE DPPPASSSDE DEVETLSGED EEEEEQISDD SSSEEEEDNL MNPINIPPLT  60
KPKPPSGSKR QSVLDRYIAR TERMEKESEG VCVPLPDDKE IEKKPIKEKE SPAVKSEKKR  120
PSESTSSKEV NAKRSKKVSE ETKRPSLFQR VWSEEDEISL LQGMIDYKAE TGDSPYDDMD  180
GFYEFTRKYI SFEASKNQFL DKIRYLKKKY MGKVGKGVES LKKAHDIECL KLFECIWGSN  240
GIALESAVKS GVKKSERKKN LVKPLGKEVE EEVVGLESVA KSNGITKKSE KKPICMDDNG  300
DKVEEEIVAL ESMVKSGVKK TEKKKKLVKP HGKEVEEEVV GFESVAKSNG ITKKSEKKPI  360
FMEDNGDKVE EEVVALESAA KSNVTPKKSR RKPISLEANG DNKEEDKDVL VNVEEYREVL  420
VNGEK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1102120KKPIKEKESPAVKSEKKRP
2385392PKKSRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013723127.15e-80PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0D3BYZ39e-80A0A0D3BYZ3_BRAOL; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.12e-39DNA-binding storekeeper protein-related transcriptional regulator