PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676787860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family TALE
Protein Properties Length: 632aa    MW: 69428.8 Da    PI: 6.7746
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676787860genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-094004371954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  676787860 400 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 437
                554459******************************88 PP

2BELL123.68e-40259330172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                erqe+q+kkakL s+l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+FrcLk+aia+qi
  676787860 259 ERQEIQMKKAKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQI 330
                79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.2E-77179328IPR006563POX domain
PfamPF075264.1E-47185327IPR006563POX domain
PROSITE profilePS5007112.26378441IPR001356Homeobox domain
CDDcd000863.48E-12381441No hitNo description
SMARTSM003892.3E-9381445IPR001356Homeobox domain
SuperFamilySSF466895.13E-17382448IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-29384448IPR009057Homeodomain-like
PfamPF059202.6E-18398437IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 632 aa     Download sequence    Send to blast
MAAYFHGNPP EISAGPDGGL QTLILMNPTT YVQYTQQDDD SNNNNNNNSN NNTNNNNNNS  60
FVFLDSHAPP QNASQQFVGI PLSGHEAASI TAADNISVLH GYPPRVQYSL YSSHQVDPTH  120
QQAACETPRA QQGLSLTLSS QQQQQQHQNQ HQTLHHVGFG SGHGEDIRVG SGSTGSGVTN  180
GIANLVSSKY LKAAQELLDE VVNADSNDIN TKSQLFSTKK GSSGTDNKAV GESSTGAGEG  240
SGGGGEASGK RTVELGTAER QEIQMKKAKL SSMLHEVEQR YRQYHQQMQM VISSFEQAAG  300
IGSAKSYTSL ALKTISRQFR CLKEAIAGQI KAANKSLGEE DSVSGVGRFE GSRLKFVDHH  360
LRQQRALQQL GMIQHPSNNA WRPQRGLPER AVSVLRAWLF EHFLHPYPKD SDKHMLAKQT  420
GLTRSQVSNW FINARVRLWK PMVEEMYMEE MKEQGKAMGS IEKTPNLDQN NEDSASKPTS  480
NQEKSPMGGG GADNYNLNPN HNGELEGVTG MQGSPKRIRT SEETMMQPIN ADFSSNEKLT  540
MKILEERQGM RSDGGYPFMG NFGQYQMDEM SRFEVAVSDQ ELLAQRYSGN NNGVSLTLGL  600
PHCDSLSSTH HQGAKLETDF FRKWICLGGI FS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16387445563Homeobox protein Meis2
3k2a_B1e-16387445563Homeobox protein Meis2
4xrs_A1e-16387444158Homeobox protein Meis1
4xrs_B1e-16387444158Homeobox protein Meis1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap676787860
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2272720.0AK227272.1 Arabidopsis thaliana mRNA for putative homeodomain transcription factor, complete cds, clone: RAFL11-09-C20.
GenBankAY0721750.0AY072175.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankAY0965480.0AY096548.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankAY0998540.0AY099854.1 Arabidopsis thaliana putative homeodomain transcription factor (At2g35940) mRNA, complete cds.
GenBankBT0084220.0BT008422.1 Arabidopsis thaliana At2g35940 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013683591.10.0BEL1-like homeodomain protein 1
RefseqXP_022554766.10.0BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A397ZVY70.0A0A397ZVY7_BRACM; Uncharacterized protein
STRINGBra017277.1-P0.0(Brassica rapa)
STRINGBo3g029830.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]