PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676785262
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family bHLH
Protein Properties Length: 306aa    MW: 34185.9 Da    PI: 7.9821
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676785262genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH52.68.4e-1773125155
                CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
        HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                ++ +hn++Er+RR++iNs f+ Lr++lP +     kKls  +++ + v+YI +Lq
  676785262  73 KKLNHNANERNRRKKINSLFSSLRSCLPGC--DEPKKLSVPQTVSRSVKYIPELQ 125
                6789*************************7..36666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088815.33272124IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.105.4E-1673138IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474594.32E-1773141IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000837.20E-1473129No hitNo description
PfamPF000103.6E-1473125IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003533.3E-1378130IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MCELGPQLLP SFGWASTGEY ENNYLVGDNH NNGTFLHFPV PKTYGVAHHQ TCSLEVSVSS  60
AGNGIDNNSV VVKKLNHNAN ERNRRKKINS LFSSLRSCLP GCDEPKKLSV PQTVSRSVKY  120
IPELQEQVKK LIQKKEDLLL RVTGQRERYV KPQPKVVASY VSTVFATKLG DSEVLVQISS  180
SKIRNFSIYN VLSGLEEDGF VLMDMSTRTA ILMHHKLQSI ETQQGQARDR KLRNLLPFEY  240
IYSIQDLEKE TPGEEFSLGL QPDNVKAVVV PMKRERRGDG GSPGEEEVVV VGEEAADQKI  300
ILVGNM
Cis-element ? help Back to Top
SourceLink
PlantRegMap676785262
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by OBP3, auxin and salicylic acid (SA). Repressed by jasmonic acid (JA), UV LIGHT, and heat treatments. Up regulated by iron deficiency in roots and leaves, as well as by nickel, high zinc or high copper treatments. Repressed by high iron, low copper and low zinc treatments. {ECO:0000269|PubMed:12679534, ECO:0000269|PubMed:12887587, ECO:0000269|PubMed:17516080}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013651482.11e-113transcription factor ORG3
SwissprotQ9M1K11e-98ORG2_ARATH; Transcription factor ORG2
TrEMBLA0A3P6B8B21e-111A0A3P6B8B2_BRACM; Uncharacterized protein
STRINGBra014971.1-P1e-111(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48228153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.11e-101bHLH family protein
Publications ? help Back to Top
  1. Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH
    Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature.
    Differentiation, 2010. 80(1): p. 1-8
    [PMID:20219281]
  2. Matsuoka K, et al.
    Gibberellin-induced expression of Fe uptake-related genes in Arabidopsis.
    Plant Cell Physiol., 2014. 55(1): p. 87-98
    [PMID:24192296]
  3. Li X,Zhang H,Ai Q,Liang G,Yu D
    Two bHLH Transcription Factors, bHLH34 and bHLH104, Regulate Iron Homeostasis in Arabidopsis thaliana.
    Plant Physiol., 2016. 170(4): p. 2478-93
    [PMID:26921305]
  4. Shen C, et al.
    Involvement of endogenous salicylic acid in iron-deficiency responses in Arabidopsis.
    J. Exp. Bot., 2016. 67(14): p. 4179-93
    [PMID:27208542]
  5. Liang G,Zhang H,Li X,Ai Q,Yu D
    bHLH transcription factor bHLH115 regulates iron homeostasis in Arabidopsis thaliana.
    J. Exp. Bot., 2017. 68(7): p. 1743-1755
    [PMID:28369511]
  6. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  7. Kailasam S,Wang Y,Lo JC,Chang HF,Yeh KC
    S-Nitrosoglutathione works downstream of nitric oxide to mediate iron-deficiency signaling in Arabidopsis.
    Plant J., 2018. 94(1): p. 157-168
    [PMID:29396986]
  8. Kurt F,Filiz E
    Genome-wide and comparative analysis of bHLH38, bHLH39, bHLH100 and bHLH101 genes in Arabidopsis, tomato, rice, soybean and maize: insights into iron (Fe) homeostasis.
    Biometals, 2018. 31(4): p. 489-504
    [PMID:29546482]