PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676784650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family SBP
Protein Properties Length: 181aa    MW: 20883.3 Da    PI: 9.863
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676784650genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.75.1e-4163138277
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                Cqv++C+a+l++ak+y rrh+vCevh+ka++++v+g +qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk +
  676784650  63 CQVDRCTANLTDAKQYDRRHRVCEVHAKASAATVAGAKQRFCQQCSRFHELSEFDESKRSCRRRLAGHNERRRKIS 138
                *************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114131.15460137IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.4E-3161124IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-3762140IPR004333Transcription factor, SBP-box
PfamPF031102.1E-3163136IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MEGQRSQRWG YLKDKATVSN LAEEEMENSM YGEEDDGGDE DKRKRVMERA RGPNTDRVPL  60
RLCQVDRCTA NLTDAKQYDR RHRVCEVHAK ASAATVAGAK QRFCQQCSRF HELSEFDESK  120
RSCRRRLAGH NERRRKISGD GFGEGSGRRG FSGQLIQNQD RNRVDIKLPM TNSSFKRPEI  180
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3860136884squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00359DAPTransfer from AT3G15270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0037140.0BT003714.1 Arabidopsis thaliana At3g15270 mRNA, complete cds.
GenBankAK1186110.0AK118611.1 Arabidopsis thaliana At3g15270 mRNA for squamosa promoter binding protein-like 5, putative, complete cds, clone: RAFL19-86-N19.
GenBankAJ2429600.0AJ242960.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 5, (SPL5 gene).
GenBankAJ0116100.0AJ011610.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638829.11e-112PREDICTED: squamosa promoter-binding-like protein 5
SwissprotQ9S7581e-107SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLA0A078E9121e-112A0A078E912_BRANA; BnaC05g38350D protein
TrEMBLA0A0D3CJZ01e-112A0A0D3CJZ0_BRAOL; Uncharacterized protein
STRINGBra027265.1-P1e-110(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.15e-79squamosa promoter binding protein-like 5