PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676782032
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family M-type_MADS
Protein Properties Length: 222aa    MW: 25213 Da    PI: 9.7175
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676782032genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.33.1e-161049241
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
               +ien++ r+ t+ kR+ g+lKKA+EL +LCd+  a+ i s
  676782032 10 FIENETTRKSTYKKRKRGLLKKAYELATLCDVPMAIFIES 49
               8*******************************99998866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.9E-21160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.839150IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-22295IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-12323IPR002100Transcription factor, MADS-box
PfamPF003198.3E-161050IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MTRKKVNLAF IENETTRKST YKKRKRGLLK KAYELATLCD VPMAIFIESQ FDPSPEVYPS  60
REAVDKVLSQ WKALSVMDKT KKMMNQETYL QQRINKATES CRKLGRENRE LAMKEVMFDC  120
LSGKTSPAQV EKSDLRDLGF TIDHYLKDLN HRIEFLMKND GSSSSSVPPP PPPPPPAAAT  180
TSLPMPTVEK GSSSTGFDDM IREQIQINLN KKPTVRDLDL NQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVNLAFIENETTRKSTYKKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMap676782032
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010421522.16e-94PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A078GER93e-91A0A078GER9_BRANA; BnaC02g40080D protein
TrEMBLA0A0D3AXE13e-91A0A0D3AXE1_BRAOL; Uncharacterized protein
STRINGXP_010421522.12e-93(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.18e-72M-type_MADS family protein