PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676782010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family M-type_MADS
Protein Properties Length: 214aa    MW: 24602.3 Da    PI: 9.3524
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676782010genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.75.5e-17343242
               ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
     SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
               +ien++ r+ t+ kR+ g+lKKA+EL +LCd+  avii s+
  676782010  3 FIENETSRKSTYKKRKSGLLKKAYELETLCDVPMAVIIDSE 43
               8************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.2E-13153IPR002100Transcription factor, MADS-box
CDDcd002664.99E-20178No hitNo description
PROSITE profilePS5006616.904143IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.02E-19288IPR002100Transcription factor, MADS-box
PfamPF003195.9E-17343IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-61631IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-63152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MAFIENETSR KSTYKKRKSG LLKKAYELET LCDVPMAVII DSEYEASPEV YPSREAVERV  60
VSQWKILPMM EKTKKMVNQE TYLQQRISKA TECWRKTRKE NRELAMKQVM FDCLSGKTSP  120
SRVEKSDLRD LGCVIDQHLK DLNRRIEVLA KNNGSPSSSV PPPPPPADAT TSVTMPIVER  180
GSSSTEFYDR IREQIQINLN MKQTIKDLDL NQKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap676782010
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010421527.13e-98PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK37e-49AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLS6B3Z03e-98S6B3Z0_TURGL; Agamous-like MADS-box protein AGL35
STRINGBostr.29827s0156.1.p7e-98(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.11e-85M-type_MADS family protein
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]