PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676779348
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family CO-like
Protein Properties Length: 255aa    MW: 27649.8 Da    PI: 7.3081
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676779348genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.11.5e-07436436
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
               + C+ +++  + l+C+ +  +lC +C ++ H  
  676779348  4 KLCDSCKSATAALYCRPDAAFLCLSCDSKVHAA 36
               68***************************9954 PP

2CCT70.73.6e-24188231144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++
  676779348 188 REARVMRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRT 231
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.438148IPR000315B-box-type zinc finger
SMARTSM003364.2E-13148IPR000315B-box-type zinc finger
PfamPF006435.9E-6443IPR000315B-box-type zinc finger
CDDcd000215.79E-10548No hitNo description
PROSITE profilePS5101716.767188230IPR010402CCT domain
PfamPF062034.2E-18188230IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MASKLCDSCK SATAALYCRP DAAFLCLSCD SKVHAANKLA SRHARVWMCE VSADAVPGDS  60
PEMNTGQQFL FSDPDPYLDL DYGTVDPKLE SQEQNSSGTD GVVPVENRAV RVSTVNENCY  120
ELDFTGGSKA FTYGYNCISH SVSSSSLEVG VVPDGGSVAD VSYPYGGAAT SGTDPGTQRA  180
VPLTSAEREA RVMRYREKRK NRKFEKTIRY ASRKAYAEMR PRIKGRFAKR TDTSESNDVV  240
GHAGIFSGFG LVPTF
Cis-element ? help Back to Top
SourceLink
PlantRegMap676779348
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3526610.0AK352661.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-06-O04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013611790.11e-132PREDICTED: zinc finger protein CONSTANS-LIKE 4
SwissprotQ940T91e-124COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A087GD111e-141A0A087GD11_ARAAL; Uncharacterized protein
STRINGA0A087GD111e-141(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27602765
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-125CONSTANS-like 4