PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676777546
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family CO-like
Protein Properties Length: 437aa    MW: 48657.5 Da    PI: 5.811
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676777546genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.58.6e-062052335
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                  C+ ++e  + lfC+ +   lC  C ++ H 
  676777546 20 RVPCDFCSERTAVLFCRADTAKLCLPCDQHVHT 52
               678******99******************9994 PP

2zf-B_box21.74.1e-076394334
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                ++C+++++++++  C++++  lC++C    H
  676777546 63 SQICDNCGNEPVSVRCFTDNLVLCQECDWDVH 94
               689************************98777 PP

3CCT661e-22389433145
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                R +a++RYkeKrktR+++K+irYesRKa+A++R RvKGrFvk++e
  676777546 389 RGNAMQRYKEKRKTRRYDKTIRYESRKARADTRLRVKGRFVKASE 433
                7789**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.5421865IPR000315B-box-type zinc finger
SMARTSM003363.2E-121865IPR000315B-box-type zinc finger
CDDcd000211.19E-72165No hitNo description
PROSITE profilePS501198.60361108IPR000315B-box-type zinc finger
CDDcd000213.46E-86594No hitNo description
SMARTSM003360.8466108IPR000315B-box-type zinc finger
PfamPF062034.7E-17389431IPR010402CCT domain
PROSITE profilePS5101714.951389431IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MENNLERERE ERRVMGSSER VPCDFCSERT AVLFCRADTA KLCLPCDQHV HTANLLSRKH  60
VRSQICDNCG NEPVSVRCFT DNLVLCQECD WDVHGSCSVS DAHVRSAVEG FSGCPSALEL  120
AALWGLDLEG RKEESQGPMM MMMMENFGSQ LDSWVSGSNV LQELVVPVPK DTTTFKKRGS  180
TCGRYKQVLC RQLEELLKNG VVDGDGDCDG DGEGGGEEVK EGITVPEMAE TERLGWKRDE  240
EVVQQPPTTT FTSLLWNAAN PSVGQSTQIW DFNLGQSREP EDSSRTTPAY VTKDAASFTI  300
NNFVDLLNDT CSTKAKGVKE ICKDDYKLSM SGQVPATSES NIRPITFGSE KGSNSSSELR  360
FAENTAGTSC KTTRLVATKA DLEQLAQNRG NAMQRYKEKR KTRRYDKTIR YESRKARADT  420
RLRVKGRFVK ASEAHYP
Cis-element ? help Back to Top
SourceLink
PlantRegMap676777546
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415704.10.0zinc finger protein CONSTANS-LIKE 15
SwissprotQ9C7E80.0COL15_ARATH; Zinc finger protein CONSTANS-LIKE 15
TrEMBLV4KVL40.0V4KVL4_EUTSA; Uncharacterized protein
STRINGBostr.15697s0122.1.p0.0(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38712647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28050.10.0B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]