PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676774398
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family CPP
Protein Properties Length: 714aa    MW: 78789 Da    PI: 6.0499
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676774398genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.93e-16419457240
        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  676774398 419 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCVDCFNKP 457
                689**********************************96 PP

2TCR521.4e-16503541139
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  676774398 503 RHKRGCNCKKSSCLKKYCECFQGGVGCSINCRCEGCKNA 541
                589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19418459IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.323419543IPR005172CRC domain
PfamPF036387.9E-12421456IPR005172CRC domain
SMARTSM011141.7E-17503544IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.7E-12505541IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009934Biological Processregulation of meristem structural organization
GO:0048444Biological Processfloral organ morphogenesis
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MENSQKKKST SQIETPTPKS KFEDSPVFNY INNLSPIEAV KSISTAQTFS SLSFTSPPPV  60
FTSPHANFHR ESRFFRCHNS VDRSKALESL DGSVPKEEVV ASGDVDLNKD ATFEEEEEDG  120
EEENSTETSS DLPQVLKSDS QTPDHVDSPC TGDIVTEVLR DPSGPSRGED NASSSEDVNV  180
RLQKILDAQE ENDTPAHRRL ISEAAELLVF RSPNDSEAFR CLVDKISSSE RRFCAGVKLT  240
NQHDITKDVP ANGSSNDNET SAVVPNQPGS GLHRGTMRRR CLDFEVPGKR KKDIADDQQN  300
VCDNKAESSS KCVVPGIGLH LNAVAMAARD SKINVIHEYS TSGEIQKSFS GSTTPVYSQD  360
IMRETLDQAE SERGEGLAVE EEAPKGLVFE ELIPGSLKKK KQVFSFEKPR LEQAGEGESC  420
KRCNCKKSKC LKLYCECFAA GVYCIEPCSC VDCFNKPIHE ETVLATRKQI ESRNPLAFAP  480
KVIRNSDSME TNDDASKTPA SARHKRGCNC KKSSCLKKYC ECFQGGVGCS INCRCEGCKN  540
AFGRKDAYLL AIMESKQEED HETYEKRTAK IQQNSDLSKE VEQNPSSDQP LTPLPPYRHM  600
VVHQPFLSKN RLPPTQFFLG AASSSFRKPD GDLTESRNEK KPLETVAEDK TEIMPEILSN  660
TPITTIKAIS PNSKRVSPPH IGSSESGSIL GKRSNGRKLI LRSIPAFPSL NPNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-1642154012120Protein lin-54 homolog
5fd3_B5e-1642154012120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1277291RRRCLDFEVPGKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00370DAPTransfer from AT3G22780Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676774398
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2040590.0AF204059.1 Arabidopsis thaliana CXC domain protein TSO1 (TSO1) mRNA, complete cds.
GenBankAF2063240.0AF206324.1 Arabidopsis thaliana putative DNA binding protein (tso1) mRNA, tso1-3 allele, complete cds.
GenBankAY0460190.0AY046019.1 Arabidopsis thaliana putative DNA binding protein (At3g22780) mRNA, complete cds.
GenBankAY1426420.0AY142642.1 Arabidopsis thaliana putative DNA binding protein (At3g22780) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406129.10.0CRC domain-containing protein TSO1
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLV4LYI40.0V4LYI4_EUTSA; Uncharacterized protein
STRINGXP_006406129.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]