PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676774396
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family CPP
Protein Properties Length: 602aa    MW: 65405.1 Da    PI: 6.6948
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676774396genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.73.5e-16316354240
        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  676774396 316 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 354
                689**********************************96 PP

2TCR52.31.1e-16401439139
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  676774396 401 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 439
                589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-19315356IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.458316441IPR005172CRC domain
PfamPF036385.6E-12318353IPR005172CRC domain
SMARTSM011144.2E-17401442IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.5E-12403439IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MDTPEKTVTQ IGTPVSKLKV ENSPVFNYIN SLSPINTVKS LPIAHTFGPL SFASPHSVFT  60
SPHVVSHKGS RFKSNSSDLS KVGPGSTGEE VVDEALLEAE PPQIHQNDCT NITTPKVIKG  120
GSCEDGETDL QKMCDGNVKR ISDTPDWEAL ISETDILMYG SPTDSEASRC FLQRSTDSKT  180
RSSGGTKSRL EPVSNSNEPE SSDALSILHR GVRRRCLDFE MPGNNKQTLG ESSSGFVVPS  240
IGLHLNAIAM SSKDSNVGNE YSFSGNVKVG LQNSTTELLP SHDIVRENVT VEAAGQSVEE  300
VPNSRKSEQA GDVESSCKRC NCKKSKCLKL YCECFAAGVY CIEPCSCIDC FNKPIHEETV  360
LATRKQIESR NPLAFAPKVI RNADSIMEVG DDASKTPASA RHKRGCNCKK SNCLKKYCEC  420
YQSGVGCSIN CRCEGCKNAF GRKDGSLFGG MDSEQDNETS GKSKSQQNVE SFNSVPIPPS  480
TPMPLRQPLA ELPISSNNRM IPQHSQHLHG ASGSSLYDGQ SFSKQDMSLL SHSRFETITE  540
ESADDIENLI QSPITNINAV SPNSKRVSLP QHDSSESTLW RRNGARKLLL SIPTFPSLTP  600
HN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1631843812120Protein lin-54 homolog
5fd3_B1e-1631843812120Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00044PBMTransfer from AT3G22760Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676774396
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2051421e-174AF205142.1 Arabidopsis thaliana CXC domain containing TSO1-like protein 1 (SOL1) mRNA, complete cds.
GenBankAY0996531e-174AY099653.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
GenBankAY1288371e-174AY128837.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024015205.10.0protein tesmin/TSO1-like CXC 3
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A398AQK70.0A0A398AQK7_BRACM; Uncharacterized protein
STRINGBo1g104900.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]