PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676768896
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family M-type_MADS
Protein Properties Length: 107aa    MW: 12532.3 Da    PI: 5.9437
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676768896genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF35.31.5e-11641338
               --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEE CS
     SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevavi 38
               i+n+s  ++tf kR+  i+ K +ELS+L d++ +v+
  676768896  6 ISNDSSSKTTFEKRKRDIMQKLKELSTLSDIKSCVL 41
               9*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006610.148141IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.11E-8342IPR002100Transcription factor, MADS-box
PfamPF003191.2E-8641IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MTLALISNDS SSKTTFEKRK RDIMQKLKEL STLSDIKSCV LSEMTHYKQT VDQEATVDQE  60
TTVDQETFLR QQIAETSEIL KKLRNDNREL EMTGVMLQRL VRKMEFQ
Cis-element ? help Back to Top
SourceLink
PlantRegMap676768896
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022159723.18e-20agamous-like MADS-box protein AGL80
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.13e-17AGAMOUS-like 80