PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676768780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family G2-like
Protein Properties Length: 408aa    MW: 46206.1 Da    PI: 8.022
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676768780genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.2e-32230283255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  676768780 230 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 283
                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15227283IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-28228283IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-23230283IPR006447Myb domain, plants
PfamPF002492.8E-7231282IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWQRRRP TTDQEDHEEL DLGFWRRALD SRTSSLVSNS  60
SSKTTNNHHH PLEDLSLSNN SHHHQHQHQH QHQQQHHHHP QLLPNCNGSN ILTSFQFPTQ  120
QQHLQGFLAH DLNTHLRPIR GIPLYQNPPP HHHHHRPPPC FPFDPSSLIP SSSPAPTGIN  180
NNSNSFGTST VSNSGLLTNP NYHNHQHHHQ TLTRPRFMPR FPAKRSMRAP RMRWTTTLHA  240
RFVHAVELLG GHERATPKSV LELMDVKDLT LAHVKSHLQM YRTVKTTDKA AASSGQSELY  300
ENGSSGDNNS DDWMLDMNRK SRDSDELTNP LEKSNGLWTN SSGEARLHGK LIDNVAEIML  360
PSEGFKQKEI EGKCSSYERI SSEEMSSSSI SGTSPFKPNL EFTLGRSH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613867.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6160.0KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0D2ZR210.0A0A0D2ZR21_BRAOL; Uncharacterized protein
STRINGBra023254.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-177G2-like family protein