PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676764350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 284aa    MW: 31507.3 Da    PI: 6.3715
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676764350genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.33.1e-33142199259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers+edp++v++tYeg+H h+
  676764350 142 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSRCTVKKRVERSSEDPSIVITTYEGQHCHQ 199
                8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-34126200IPR003657WRKY domain
SuperFamilySSF1182901.96E-28133199IPR003657WRKY domain
PROSITE profilePS5081129.838136201IPR003657WRKY domain
SMARTSM007749.6E-39141200IPR003657WRKY domain
PfamPF031063.5E-26142199IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MNNDPENPDL SNDSAWTQLT ASDSDFFDRD TSNILSDFGW NLHASSSSDH HHNNLQLDSD  60
LKPSSGVPSP VPAATASAAV TEVSTSNNPS ATSSSSEDPT ENSTASATKT PETPKKEKKQ  120
VQKRIRQPRF AFMTKSDVDN LEDGYRWRKY GQKAVKNSPF PRSYYRCTNS RCTVKKRVER  180
SSEDPSIVIT TYEGQHCHQT IGFPRGGILT AHDSHNFTSH HHLPPPLPNP YYYQELLDQL  240
HRDNTSSPRL PQSTTEEGPA AVTSNNPSEE GLLGDIVPQT MRNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-25131198774Probable WRKY transcription factor 4
2lex_A1e-25131198774Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676764350
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931340.0KM593134.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY14) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013588933.11e-158PREDICTED: probable WRKY transcription factor 57
RefseqXP_013588934.11e-158PREDICTED: probable WRKY transcription factor 57
RefseqXP_013588935.11e-158PREDICTED: probable WRKY transcription factor 57
RefseqXP_013700904.11e-158probable WRKY transcription factor 57
SwissprotQ9C9831e-136WRK57_ARATH; Probable WRKY transcription factor 57
TrEMBLA0A078HQM01e-156A0A078HQM0_BRANA; BnaC06g30480D protein
TrEMBLA0A0D3CZ751e-156A0A0D3CZ75_BRAOL; Uncharacterized protein
TrEMBLA0A3P6FZP81e-156A0A3P6FZP8_BRAOL; Uncharacterized protein
STRINGBo6g108750.11e-157(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49952753
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.21e-113WRKY DNA-binding protein 57
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Jiang Y,Qiu Y,Hu Y,Yu D
    Heterologous Expression of AtWRKY57 Confers Drought Tolerance in Oryza sativa.
    Front Plant Sci, 2016. 7: p. 145
    [PMID:26904091]
  3. Jiang Y,Yu D
    The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance.
    Plant Physiol., 2016. 171(4): p. 2771-82
    [PMID:27268959]
  4. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]