PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676762314
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 428aa    MW: 46767 Da    PI: 9.8116
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676762314genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.83.5e-31160216360
                -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                DgynWrKYGqK+vkgs++prsYY+Ct+++Cpvkkkvers   ++v ei+Y+geHnh+k
  676762314 160 DGYNWRKYGQKQVKGSDCPRSYYKCTHPKCPVKKKVERSM-GGQVSEIVYQGEHNHSK 216
                9***************************************.***************85 PP

2WRKY1031.6e-32348405259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                +Dg++WrKYGqK+v g+ +prsYYrCtsa+C+++k+ver+++dp+++++tYeg+Hnh+
  676762314 348 EDGFRWRKYGQKVVGGNAYPRSYYRCTSANCRARKHVERASDDPRAFITTYEGKHNHH 405
                8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.5E-27156217IPR003657WRKY domain
SMARTSM007744.5E-32158216IPR003657WRKY domain
SuperFamilySSF1182904.84E-24159217IPR003657WRKY domain
PROSITE profilePS5081122.527160217IPR003657WRKY domain
PfamPF031063.2E-24160214IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.3E-32337405IPR003657WRKY domain
PROSITE profilePS5081131.72342407IPR003657WRKY domain
SuperFamilySSF1182904.58E-27343405IPR003657WRKY domain
SMARTSM007743.9E-38347406IPR003657WRKY domain
PfamPF031066.9E-26348405IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MEVKESERAV IAKPVASRPS CSSIKTFTEL LTDSVTVSPQ LNCHETVDAA IRPKTLRFKQ  60
PAAASVSCPR VEVNGNGKSC DDSERRNYVV YKPKAKLVSK ATVSVLANMG NRQQTWRQGE  120
AVTYGKSVSQ GTRRAGPNLV PRVPSFSESE ASMGDRSSVD GYNWRKYGQK QVKGSDCPRS  180
YYKCTHPKCP VKKKVERSMG GQVSEIVYQG EHNHSKPSCP LPRRASSSSS SGFQKPPKGG  240
PVSEGSMGQD PNNVCYRPLW SNQGNDSSKS ITEKMNEGCV VTPFEFAVPR SANSTGGTSD  300
SGCRSSQCDE GSIGGELDDP SRSKRRKNEK QSSEAGVSQS SGESDSLEDG FRWRKYGQKV  360
VGGNAYPRSY YRCTSANCRA RKHVERASDD PRAFITTYEG KHNHHLLLRS PTSSTLPLTS  420
SQHSNQAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-29147406378Probable WRKY transcription factor 4
2lex_A8e-29147406378Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Regulates trichome development, production of mucilage and tannin in seed coats, and maybe root hair development. {ECO:0000269|PubMed:12084832}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap676762314
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by salicylic acid or wounding. {ECO:0000269|PubMed:12084832}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010505305.10.0PREDICTED: WRKY transcription factor 44-like isoform X2
SwissprotQ9ZUU00.0WRK44_ARATH; WRKY transcription factor 44
TrEMBLA0A384L2V30.0A0A384L2V3_ARATH; WRKY44
TrEMBLA7BI370.0A7BI37_ARATH; WRKY transcription factor
STRINGCagra.0666s0018.1.p0.0(Capsella grandiflora)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83622740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.10.0WRKY family protein
Publications ? help Back to Top
  1. Kim K,Jiang K,Teng SL,Feldman LJ,Huang H
    Using biologically interrelated experiments to identify pathway genes in Arabidopsis.
    Bioinformatics, 2012. 28(6): p. 815-22
    [PMID:22271267]
  2. Simon M, et al.
    Tissue-specific profiling reveals transcriptome alterations in Arabidopsis mutants lacking morphological phenotypes.
    Plant Cell, 2013. 25(9): p. 3175-85
    [PMID:24014549]
  3. Ranocha P,Francoz E,Burlat V,Dunand C
    Expression of PRX36, PMEI6 and SBT1.7 is controlled by complex transcription factor regulatory networks for proper seed coat mucilage extrusion.
    Plant Signal Behav, 2014. 9(11): p. e977734
    [PMID:25531128]
  4. Verweij W, et al.
    Functionally Similar WRKY Proteins Regulate Vacuolar Acidification in Petunia and Hair Development in Arabidopsis.
    Plant Cell, 2016. 28(3): p. 786-803
    [PMID:26977085]
  5. Gonzalez A, et al.
    TTG2 controls the developmental regulation of seed coat tannins in Arabidopsis by regulating vacuolar transport steps in the proanthocyanidin pathway.
    Dev. Biol., 2016. 419(1): p. 54-63
    [PMID:27046632]
  6. Hassani-Pak K, et al.
    Developing integrated crop knowledge networks to advance candidate gene discovery.
    Appl Transl Genom, 2016. 11: p. 18-26
    [PMID:28018846]