PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676760548
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family LBD
Protein Properties Length: 205aa    MW: 23413 Da    PI: 9.8914
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676760548genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.71e-3424115192
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g +++++++l+  k+
  676760548  24 ACASCKHQRKKCNNECILSPYFPARKTKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSDSLTWEALWRQKDPVLGSYGEYRRISEELKLYKS 115
                7************************************************************************************9998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.14123123IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-3224115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MMQRNSNNNT NNSNISDNSS PHQACASCKH QRKKCNNECI LSPYFPARKT KEFQAVHKVF  60
GVSNVQKMVR TVREEDRTKL SDSLTWEALW RQKDPVLGSY GEYRRISEEL KLYKSLVHNQ  120
PLIGWDNNQR VFNNNNTNKN ELAINSSGSG GFSGNSNGVG VNREIINGGY TSRNLQGGWE  180
NIKQDQRQQQ CYAVINGFKQ HYLPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-18251011288LOB family transfactor Ramosa2.1
5ly0_B8e-18251011288LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676760548
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417938.11e-124LOB domain-containing protein 2
SwissprotQ9LNB91e-119LBD2_ARATH; LOB domain-containing protein 2
TrEMBLV4MVQ11e-122V4MVQ1_EUTSA; Uncharacterized protein
STRINGXP_006417938.11e-123(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.15e-95LOB domain-containing protein 2