PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676759968
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 507aa    MW: 54951.8 Da    PI: 8.7773
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676759968genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.92.4e-34223279259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                dDgynWrKYGqK+vkgsefprsYY+Ct +gCpvkkkvers  d++v+ei+Y+g+Hnhe
  676759968 223 DDGYNWRKYGQKQVKGSEFPRSYYKCTNPGCPVKKKVERSL-DGQVTEIIYKGQHNHE 279
                8****************************************.***************8 PP

2WRKY105.52.7e-33403461159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+a+dpk+v++tYeg+Hnh+
  676759968 403 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTQGCGVRKHVERAATDPKAVVTTYEGKHNHD 461
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-30217281IPR003657WRKY domain
SuperFamilySSF1182902.62E-26221281IPR003657WRKY domain
SMARTSM007746.6E-39222280IPR003657WRKY domain
PROSITE profilePS5081124.857223281IPR003657WRKY domain
PfamPF031062.1E-26223279IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-36388463IPR003657WRKY domain
SuperFamilySSF1182901.19E-29395463IPR003657WRKY domain
PROSITE profilePS5081138.32398463IPR003657WRKY domain
SMARTSM007743.2E-39403462IPR003657WRKY domain
PfamPF031065.9E-26404461IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MSEKEELPST SKSTAPSRPT LSLPPRPFSE MFFNGGVGFS PGPMTLVSNM FPDSDEFRSF  60
SQLLAGAMAS PAAAAASAAS ASEGNNSSSG DVDPRFKQSR PTGLMISQSP SMFTVPPGLS  120
PAMLMDSPSF LGLFSPVQGS YGMTHQQALA QVTAQAVQAN ANMQPQTEYP PSSQSQVQSF  180
SSGQPQNPTS APDSSLLAPR VTSDLAIIEQ RSQQPLNVDK PADDGYNWRK YGQKQVKGSE  240
FPRSYYKCTN PGCPVKKKVE RSLDGQVTEI IYKGQHNHEP PQNTKRGNRD STANLNGSSV  300
NNNRASSELA ASHFQTSNKT TREQHEAASQ ATTEQMSEAS DSEEVGNGET GVRKKVEDEP  360
DPKRRSTEVR VSEPAAAVAA SQSHRTVTEP RIIVQTTSEV DLLDDGYRWR KYGQKVVKGN  420
PYPRSYYKCT TQGCGVRKHV ERAATDPKAV VTTYEGKHNH DLPAAKSSSH AAAAAQLRPE  480
NRHGGLANLN QQQQPVARLR LKEEQII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-45223464878Probable WRKY transcription factor 4
2lex_A3e-45223464878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap676759968
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4258350.0AF425835.1 Arabidopsis thaliana WRKY transcription factor 4 (WRKY4) mRNA, complete cds.
GenBankAY0456760.0AY045676.1 Arabidopsis thaliana At1g13960/F7A19_5 mRNA, complete cds.
GenBankBT0026290.0BT002629.1 Arabidopsis thaliana At1g13960/F7A19_5 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417073.10.0probable WRKY transcription factor 4
RefseqXP_024008189.10.0probable WRKY transcription factor 4
SwissprotQ9XI900.0WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLV4MU440.0V4MU44_EUTSA; Uncharacterized protein
STRINGXP_006417073.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.10.0WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]