PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676758502
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 659aa    MW: 72835.3 Da    PI: 6.4325
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676758502genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY77.51.5e-24181237259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                +DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e++++ ++++e++ +g+H he
  676758502 181 RDGYNWRKYGQKQVKSPKGSRSYYRCTYSDCCAKK-IECTNDSGNMIEVVKKGSHSHE 237
                6********************************98.*********************8 PP

2WRKY99.62e-31343399359
                -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ae++ +++itY+g Hnh+
  676758502 343 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAAENTAAIIITYKGVHNHD 399
                9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.1E-20177239IPR003657WRKY domain
SuperFamilySSF1182901.57E-19178239IPR003657WRKY domain
SMARTSM007741.1E-21180238IPR003657WRKY domain
PROSITE profilePS5081116.788182239IPR003657WRKY domain
PfamPF031068.2E-17182236IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-31326401IPR003657WRKY domain
PROSITE profilePS5081132.351336401IPR003657WRKY domain
SuperFamilySSF1182909.02E-27337401IPR003657WRKY domain
SMARTSM007749.0E-36341400IPR003657WRKY domain
PfamPF031066.8E-24343399IPR003657WRKY domain
HamapMF_0136322.148529632IPR001787Ribosomal protein L21
PfamPF008291.4E-32530630IPR028909Ribosomal protein L21-like
TIGRFAMsTIGR000617.6E-26530631IPR001787Ribosomal protein L21
SuperFamilySSF1410915.36E-31530630IPR028909Ribosomal protein L21-like
PROSITE patternPS011690601623IPR018258Ribosomal protein L21, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006412Biological Processtranslation
GO:0005840Cellular Componentribosome
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0003735Molecular Functionstructural constituent of ribosome
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MDDKASDEAD VYAVENRTSE ADKCEKVEPE KELCNGEDDG LSQLRDEESL KTTDADMEDL  60
HDEAVRETLA KDQVEGAREN SSVEPNGKDV SELKERASGK ESFSSAIVSV GEIAVDNREV  120
EKSIGLTASL NPSVVEPSLS SETSALHAVS LVSVPTKPEQ GSDSRVVSNL SVSPVLRTPP  180
RDGYNWRKYG QKQVKSPKGS RSYYRCTYSD CCAKKIECTN DSGNMIEVVK KGSHSHEPPQ  240
KNSFSPREIR AVSAISPGSE YNTVVKDLAI VPCDSAPSGS TKENICQALT IVEQKRSWEN  300
EAVEEPEPKR RQDNPQSSDS VSKPGKKHKF VVHAAGDVGI SGDGYRWRKY GQKMVKGNPN  360
PRNYYRCTSA GCPVRKHIET AAENTAAIII TYKGVHNHDM PVPKKRHGPP SSMLVAAAAP  420
TSMRKPSGAS ITRGTPISNR SLSRDFPWHR LCYRSQGRHF SSKTNGTDES SQGEEEDDDD  480
EEDYEDSAEM EVEREYSPAE KVEAAAEIGY KVMGPLKPSE RLFKHYEPVF AVVQIGSHQF  540
KVSNGDSIFT EKLKFCDIND KLILTKVLLL GSASQTIIGR PILPDATVHA VVEEHALDEK  600
VLIFKKKRRK NYRRTTGHRQ ELTKLRITDI QGIEKPEPTI VHKPSKAADT EQPKAELVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4v61_BT1e-25514634115229Ribosomal Protein L21
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1604608KKKRR
2604609KKKRRK
3605609KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412655.10.0hypothetical protein EUTSA_v10025126mg
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLV4MMR70.0V4MMR7_EUTSA; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_70008520.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32