PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676756794
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family TCP
Protein Properties Length: 191aa    MW: 20938.7 Da    PI: 8.7673
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676756794genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP114.81.2e-35421388106
        TCP   8 hskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaakskksqksaas 106
                ++++hTkv+gR+RRvR++a+ aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tg+++++++ +  +ss++s+ +   +   ++++++ ++q+++++
  676756794  42 SKDRHTKVNGRGRRVRMPALAAARIFQLTRELGHRSDGETIEWLLNQAEPSIIAATGSGTNPSELV--SSSVESSPQMMFAMVPPQTQTQMQPQQPPNC 138
                79********************************************************99999333..2222222222222333333355555555555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.0E-3041125IPR005333Transcription factor, TCP
PROSITE profilePS5136927.0094296IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MVFHKLNTTE STNLNAVVAS DSRPQTQITV SKPSTGRVPA ASKDRHTKVN GRGRRVRMPA  60
LAAARIFQLT RELGHRSDGE TIEWLLNQAE PSIIAATGSG TNPSELVSSS VESSPQMMFA  120
MVPPQTQTQM QPQQPPNCRL DLCQPIGVQY SVNGYNHMPF TAMLLQPLTT AESDVEIAAE  180
ERRQREALGR S
Cis-element ? help Back to Top
SourceLink
PlantRegMap676756794
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410877.21e-94transcription factor TCP11
SwissprotQ9SJK72e-62TCP11_ARATH; Transcription factor TCP11
TrEMBLA0A1J3JRI94e-93A0A1J3JRI9_NOCCA; Transcription factor TCP11
TrEMBLV4LP213e-93V4LP21_EUTSA; Uncharacterized protein
STRINGXP_006410877.15e-94(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM152651618
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.12e-57TCP family protein