PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676753294
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family CPP
Protein Properties Length: 612aa    MW: 65127.8 Da    PI: 8.4212
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676753294genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.71.3e-14139178141
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  676753294 139 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 178
                589**************************.********986 PP

2TCR50.63.8e-16223261139
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN 
  676753294 223 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNF 261
                589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-16139179IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.079140263IPR005172CRC domain
PfamPF036387.7E-11141176IPR005172CRC domain
SMARTSM011144.4E-19223264IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-12226261IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MGEGGGGGGG GGEFPPKKEG VSDDSAAFPA KKPARQLDFT AASSDEQHSL SKPPAPTTTV  60
VATTPKHILT PSFTSPVTTT TATPTSRLHP VVRPTLPVMT PNPPSQSPIL NAPIRQHPKP  120
ESPKSRPRPM VEARDGTPQK KKQCNCKHSR CLKLYCECFA SGTYCDGCNC VNCFNNVDNE  180
PARRDAVEAT LERNPNAFRP KIASSPHGVN KREEIGEVVL LGKHNKGCHC KKSGCLKKYC  240
ECFQANILCS ENCKCLDCKN FDGSEERQAL FHGEHANNMA YLQQAANAAI TGAVGSSGFA  300
PSPLPKRRKG QDISFNQATK DSAHRHGQFQ QGNNGRTSGT SPATGSRPGG NSSAAPSKFV  360
YRSLLADIIQ PQDVKALCSV LVAVAGEAAK TLTDKRNETE NRVEDQTETS LASSAQDNSQ  420
GNKDAGDVEM VAADGNQAHK SGPEGSNSDS ADASKGKPLS PATLALMCDE QDTIFMVAAA  480
EPNGSVDPGG CRTNQQGQSE IYAEQERVVL TKFRDCLSRL ISYAEIKEAK CSYLARKHIQ  540
SPPTATATAT VKTENGIQQI PPIVNGASRT TTQPTPNKPQ PLQPTATRPA TPSTSTTHHP  600
HKPPALPEKK DP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-3014127211132Protein lin-54 homolog
5fd3_B2e-3014127211132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676753294
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009129079.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0D3A3M40.0A0A0D3A3M4_BRAOL; Uncharacterized protein
STRINGBo1g016960.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein