PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676752746
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family NF-YA
Protein Properties Length: 372aa    MW: 41418.5 Da    PI: 9.8248
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676752746genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.61.6e-31176232158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                +ep++VNaKQyq+Il+RRq+Rakle+++kl ++ rkpylheSRh hA++R+RgsgGrF
  676752746 176 NEPIFVNAKQYQAILRRRQHRAKLEAQNKL-IRVRKPYLHESRHLHAVKRARGSGGRF 232
                59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-35174235IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.89175235IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.9E-26177232IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.3E-22178200IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860180200IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.3E-22209232IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MQEFCSKVSL SCPATSWGNS AFTNSHVQGS SSSMTDNNTL SLTMEMMSTH FPGMKQNGFP  60
LQDHDSSSTQ STGGGDSSGE VASLGEHNNR YGHNHLSGYK ENGGSLSGSH PESILSKVSQ  120
NSAVPATIEA SWPLHGHETP HFNGFMSFPY ASQHTVQHHG GFIPSRMLLP HNIPENEPIF  180
VNAKQYQAIL RRRQHRAKLE AQNKLIRVRK PYLHESRHLH AVKRARGSGG RFLNTKKLQE  240
PKSPQSHFFK NPQGKVLQRE ISGVGVGSSV SKTSCSDLTG NNNDMFQENT QFRFSDDYTS  300
ENRHRIATRA ALVPCLQCVL LLAKVIMAWL ETCHFVYGQS LQKQSPRQFN KKLDNLLMEA  360
ALNGWQGIKR FC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-18177241367NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap676752746
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936133e-96AB493613.1 Arabidopsis thaliana At3g14020 mRNA for hypothetical protein, partial cds, clone: RAAt3g14020.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024015185.11e-167nuclear transcription factor Y subunit A-6 isoform X3
SwissprotQ9LVJ71e-127NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLV4NPX01e-150V4NPX0_EUTSA; Uncharacterized protein
STRINGXP_006407138.11e-151(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147331620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.11e-119nuclear factor Y, subunit A6
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]