PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676751404
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family TCP
Protein Properties Length: 906aa    MW: 99403.2 Da    PI: 8.7704
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676751404genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP744.5e-232732899
        TCP 28 caarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaakskk 99
               caar+F+L++eLG+++d++tieWLlqqa+pai++ tgt++++a++++ ++    ++ s++ ++ +++ +s  
  676751404  2 CAARVFQLTRELGHKSDGETIEWLLQQAEPAIIASTGTGTIPANFSTLNATLRGGGGSTIFAQPSKSSSSPL 73
               **************************************9999988733333333332333322222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136919.692136IPR017887Transcription factor TCP subgroup
PfamPF036342.4E-20290IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 906 aa     Download sequence    Send to blast
MCAARVFQLT RELGHKSDGE TIEWLLQQAE PAIIASTGTG TIPANFSTLN ATLRGGGGST  60
IFAQPSKSSS SPLSFHSTGM SLYDDSNGTN GSSSSAGVDP SRKLLNTATA AQNAAVFGFH  120
HQMYPPIMST ERNPNPNPSP SPSSMGKAYR EDYFKETEPS GSSQKPGQFQ DQELGPGSGM  180
GRGTANVVPQ PMWAVAPGTT NGGSAFWMLP MSGSGGREQM QQQPGHQMWA FNPGNYPVGT  240
GRVVTAPMGS MMLGGQQLGL GVAESNMAAA MRGGRGGDGL GMTLDQHQHQ HHQQHQETNQ  300
TQASANGGGD DKKYVNMLIF LATWEIFLRF ILITLLRGLT LLQHRTASEG ASVDVKKYLK  360
SSYQSTSALL LGHAMDALLV SPSLEPEKPT TEPASSMANH QPKIKPPTLE KRKLTAKNND  420
KTSFSSHSYS TSNPNSTRWV PRVTHRLRNP TVRLGMARRS IGERQAEALA LPLGMSIAAF  480
TNLVIERTNA AGKNVYVDDL AVISASAIKE SLTNVYGDKL GSFATNFERS FKSTLKILRL  540
INGSQKNSVA GFDLDRSTLE ECSDTELPAK ETSSATSSYE EIQGGPRTTP GGIRTTTLMN  600
DIVLHQETRK LCVVPRSSAM SLDPTERYLE EMARSNDLKC IKIGVSVETN NLMKAKLQKD  660
DSKAAYREQK YKTELEGKKE TDMVQKNEDW LRVSVSFMLA AMLYGTSVFS QQRIKEATSV  720
CEPSEENDSN AWWFPEQLSW LNTEFNIFVC RLRVGFQTFS GVLLFLTFAY IVVQRIPSTK  780
QTIIPFIIIF LALVCGYLGK LCVDTLGGNG NLWLCLWEVF CLLQFLANVF KLALYSFIFC  840
PISVSQGTKP SRWDIMVPYW IRRSFFFGVT WFVLPAITGL LPFATFGELW NHFTVVFVGL  900
VRGYIA
Functional Description ? help Back to Top
Source Description
UniProtMay play a role in transcriptional processes (PubMed:21875893). Regulates negatively the senescence and chlorotic lesions induced by biotic (e.g. pathogens) and abiotic (e.g. sugars, darkness) agents, probably by controlling programmed cell death (pcd) (PubMed:11846876,PubMed:9338960, Ref.6, PubMed:11728314). Negative regulator of plant programmed cell death (PCD) and effector-triggered immunity (ETI) (PubMed:25455564). Promotes cell division and endoreduplication (e.g. in trichomes) (PubMed:11728314). {ECO:0000269|PubMed:11728314, ECO:0000269|PubMed:11846876, ECO:0000269|PubMed:25455564, ECO:0000269|PubMed:9338960, ECO:0000269|Ref.6, ECO:0000305|PubMed:21875893}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap676751404
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013630388.10.0PREDICTED: protein CPR-5
SwissprotQ9LV851e-177CPR5_ARATH; Protein CPR-5
TrEMBLA0A087GE790.0A0A087GE79_ARAAL; Uncharacterized protein
STRINGA0A087GE790.0(Arabis alpina)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72010.11e-106TCP family protein
Publications ? help Back to Top
  1. Clarke JD,Volko SM,Ledford H,Ausubel FM,Dong X
    Roles of salicylic acid, jasmonic acid, and ethylene in cpr-induced resistance in arabidopsis.
    Plant Cell, 2000. 12(11): p. 2175-90
    [PMID:11090217]
  2. Chen Z,Kloek AP,Boch J,Katagiri F,Kunkel BN
    The Pseudomonas syringae avrRpt2 gene product promotes pathogen virulence from inside plant cells.
    Mol. Plant Microbe Interact., 2000. 13(12): p. 1312-21
    [PMID:11106023]
  3. Jirage D, et al.
    Constitutive salicylic acid-dependent signaling in cpr1 and cpr6 mutants requires PAD4.
    Plant J., 2001. 26(4): p. 395-407
    [PMID:11439127]
  4. Clarke JD,Aarts N,Feys BJ,Dong X,Parker JE
    Constitutive disease resistance requires EDS1 in the Arabidopsis mutants cpr1 and cpr6 and is partially EDS1-dependent in cpr5.
    Plant J., 2001. 26(4): p. 409-20
    [PMID:11439128]
  5. Deuschle K, et al.
    A nuclear gene encoding mitochondrial Delta-pyrroline-5-carboxylate dehydrogenase and its potential role in protection from proline toxicity.
    Plant J., 2001. 27(4): p. 345-56
    [PMID:11532180]
  6. Kirik V, et al.
    CPR5 is involved in cell proliferation and cell death control and encodes a novel transmembrane protein.
    Curr. Biol., 2001. 11(23): p. 1891-5
    [PMID:11728314]
  7. Yoshida S,Ito M,Nishida I,Watanabe A
    Identification of a novel gene HYS1/CPR5 that has a repressive role in the induction of leaf senescence and pathogen-defence responses in Arabidopsis thaliana.
    Plant J., 2002. 29(4): p. 427-37
    [PMID:11846876]
  8. Clarke SM,Mur LA,Wood JE,Scott IM
    Salicylic acid dependent signaling promotes basal thermotolerance but is not essential for acquired thermotolerance in Arabidopsis thaliana.
    Plant J., 2004. 38(3): p. 432-47
    [PMID:15086804]
  9. Schenk PM,Kazan K,Rusu AG,Manners JM,Maclean DJ
    The SEN1 gene of Arabidopsis is regulated by signals that link plant defence responses and senescence.
    Plant Physiol. Biochem., 2005 Oct-Nov. 43(10-11): p. 997-1005
    [PMID:16325410]
  10. Heidel AJ,Dong X
    Fitness benefits of systemic acquired resistance during Hyaloperonospora parasitica infection in Arabidopsis thaliana.
    Genetics, 2006. 173(3): p. 1621-8
    [PMID:16648642]
  11. Love AJ, et al.
    Components of Arabidopsis defense- and ethylene-signaling pathways regulate susceptibility to Cauliflower mosaic virus by restricting long-distance movement.
    Mol. Plant Microbe Interact., 2007. 20(6): p. 659-70
    [PMID:17555274]
  12. Aki T, et al.
    Distinct modulations of the hexokinase1-mediated glucose response and hexokinase1-independent processes by HYS1/CPR5 in Arabidopsis.
    J. Exp. Bot., 2007. 58(12): p. 3239-48
    [PMID:17720689]
  13. Jing HC,Anderson L,Sturre MJ,Hille J,Dijkwel PP
    Arabidopsis CPR5 is a senescence-regulatory gene with pleiotropic functions as predicted by the evolutionary theory of senescence.
    J. Exp. Bot., 2007. 58(14): p. 3885-94
    [PMID:18033818]
  14. Brininstool G, et al.
    Constitutive Expressor Of Pathogenesis-related Genes5 affects cell wall biogenesis and trichome development.
    BMC Plant Biol., 2008. 8: p. 58
    [PMID:18485217]
  15. Jing HC, et al.
    Early leaf senescence is associated with an altered cellular redox balance in Arabidopsis cpr5/old1 mutants.
    Plant Biol (Stuttg), 2008. 10 Suppl 1: p. 85-98
    [PMID:18721314]
  16. Fujisaki K,Iwahashi F,Kaido M,Okuno T,Mise K
    Genetic analysis of a host determination mechanism of bromoviruses in Arabidopsis thaliana.
    Virus Res., 2009. 140(1-2): p. 103-11
    [PMID:19059442]
  17. Jing HC,Dijkwel PP
    CPR5: A Jack of all trades in plants.
    Plant Signal Behav, 2008. 3(8): p. 562-3
    [PMID:19704469]
  18. Meng PH, et al.
    Crosstalks between myo-inositol metabolism, programmed cell death and basal immunity in Arabidopsis.
    PLoS ONE, 2009. 4(10): p. e7364
    [PMID:19812700]
  19. Gao G, et al.
    Arabidopsis CPR5 independently regulates seed germination and postgermination arrest of development through LOX pathway and ABA signaling.
    PLoS ONE, 2011. 6(4): p. e19406
    [PMID:21556325]
  20. Trotta A, et al.
    Regulatory subunit B'gamma of protein phosphatase 2A prevents unnecessary defense reactions under low light in Arabidopsis.
    Plant Physiol., 2011. 156(3): p. 1464-80
    [PMID:21571669]
  21. Borghi M,Rus A,Salt DE
    Loss-of-function of Constitutive Expresser of Pathogenesis Related Genes5 affects potassium homeostasis in Arabidopsis thaliana.
    PLoS ONE, 2011. 6(10): p. e26360
    [PMID:22046278]
  22. Orjuela J, et al.
    A recessive resistance to rice yellow mottle virus is associated with a rice homolog of the CPR5 gene, a regulator of active defense mechanisms.
    Mol. Plant Microbe Interact., 2013. 26(12): p. 1455-63
    [PMID:23944999]
  23. Okuma E,Nozawa R,Murata Y,Miura K
    Accumulation of endogenous salicylic acid confers drought tolerance to Arabidopsis.
    Plant Signal Behav, 2014. 9(3): p. e28085
    [PMID:24603484]
  24. Bruggeman Q, et al.
    The Polyadenylation Factor Subunit CLEAVAGE AND POLYADENYLATION SPECIFICITY FACTOR30: A Key Factor of Programmed Cell Death and a Regulator of Immunity in Arabidopsis.
    Plant Physiol., 2014. 165(2): p. 732-746
    [PMID:24706550]
  25. Bao Z,Hua J
    Interaction of CPR5 with cell cycle regulators UVI4 and OSD1 in Arabidopsis.
    PLoS ONE, 2014. 9(6): p. e100347
    [PMID:24945150]
  26. Meng Z,Ruberti C,Gong Z,Brandizzi F
    CPR5 modulates salicylic acid and the unfolded protein response to manage tradeoffs between plant growth and stress responses.
    Plant J., 2017. 89(3): p. 486-501
    [PMID:27747970]
  27. Wang F, et al.
    Arabidopsis CPR5 regulates ethylene signaling via molecular association with the ETR1 receptor.
    J Integr Plant Biol, 2017. 59(11): p. 810-824
    [PMID:28708312]
  28. Höwing T,Dann M,Hoefle C,Hückelhoven R,Gietl C
    Involvement of Arabidopsis thaliana endoplasmic reticulum KDEL-tailed cysteine endopeptidase 1 (AtCEP1) in powdery mildew-induced and AtCPR5-controlled cell death.
    PLoS ONE, 2017. 12(8): p. e0183870
    [PMID:28846731]
  29. Bowling SA,Clarke JD,Liu Y,Klessig DF,Dong X
    The cpr5 mutant of Arabidopsis expresses both NPR1-dependent and NPR1-independent resistance.
    Plant Cell, 1997. 9(9): p. 1573-84
    [PMID:9338960]