PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676750298
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 550aa    MW: 60174.6 Da    PI: 8.3531
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676750298genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.17.4e-33283339259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                dDgynWrKYGqK+vkgs+ prsYY+Ct++ Cpvkkkvers  d++v+ei+Y+g+H h+
  676750298 283 DDGYNWRKYGQKQVKGSDSPRSYYKCTHPACPVKKKVERSL-DGQVTEIIYKGQHSHD 339
                8****************************************.***************7 PP

2WRKY1053.9e-33450508159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+vkg+++prsYY+Ct++ C v+k+ver+a+dpk+v++tYeg+Hnh+
  676750298 450 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTPACGVRKHVERAANDPKAVVTTYEGKHNHD 508
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.6E-28274341IPR003657WRKY domain
PROSITE profilePS5081123.629277341IPR003657WRKY domain
SuperFamilySSF1182903.4E-25280341IPR003657WRKY domain
SMARTSM007743.0E-35282340IPR003657WRKY domain
PfamPF031066.2E-25283339IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.1E-36435510IPR003657WRKY domain
SuperFamilySSF1182903.4E-29442510IPR003657WRKY domain
PROSITE profilePS5081137.39445510IPR003657WRKY domain
SMARTSM007746.9E-38450509IPR003657WRKY domain
PfamPF031061.7E-25451508IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MAKKEEEEEQ QQEQEQPLTL KPSTGGASRS RPTISLPPRP FGEMFFSGGV GFSGFSPGPM  60
TLVSNLFSDP DEFKSFSQLL AGAMASPAAA VAAAAVVASA HQTSVSSVGG NGDNGGDVDP  120
RFKQNRPTGL MITQPPAMFT VPPGLSPATL LDSPSFFGLF SPIQVKIREK FDFDELRMFL  180
CILKVGNFQT KGTFGMTHQQ ALAQVTAQAV QGSNVQMQSQ SEFPCTTQQQ ETSLTEVLPS  240
SSSGPRSQIP APVRDSSQAQ RGTLEVSVYE HRSQPQNADK PADDGYNWRK YGQKQVKGSD  300
SPRSYYKCTH PACPVKKKVE RSLDGQVTEI IYKGQHSHDP PQNTKRGGNN NGSSKSSDIA  360
TQFQTSNSSL NKTKRDQETS QVTTTEQMSE ASDSEEVGNA DTSVGRNHED EPDPKRRNVE  420
GRVSEPASST HRTVTEPRII VQTTSEVDLL DDGYRWRKYG QKVVKGNPYP RSYYKCTTPA  480
CGVRKHVERA ANDPKAVVTT YEGKHNHDVP AARTSSHQLR PNNNIHNTSA VNLNQQQAVA  540
RLRLKEEQIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-44283511878Probable WRKY transcription factor 4
2lex_A7e-44283511878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676750298
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395712.10.0probable WRKY transcription factor 3
SwissprotQ9ZQ700.0WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLV4KZY40.0V4KZY4_EUTSA; Uncharacterized protein
STRINGXP_006395712.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.10.0WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]