PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676750094
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 175aa    MW: 19517.5 Da    PI: 6.2447
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676750094genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.97.8e-32114172159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDg++WrKYG+K+vk+s++pr+YY+C+  gCpvkk+ver+++dp++v++tYeg Hnh+
  676750094 114 LDDGFKWRKYGKKMVKNSPNPRNYYKCSADGCPVKKRVERDRDDPSFVITTYEGFHNHS 172
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.3E-34100173IPR003657WRKY domain
SuperFamilySSF1182902.22E-28107172IPR003657WRKY domain
PROSITE profilePS5081130.136109174IPR003657WRKY domain
SMARTSM007745.5E-37114173IPR003657WRKY domain
PfamPF031062.0E-25115171IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MNDAETNLAR SLSDETHSGF ELADLYLSDE WMDDDLVSAV SGMTHSYGYQ TGDDAHHAAD  60
FFSGSSSSFP PPESPSTNAS VAAAKAAAEK QTKKEKKKVK ERVAFKTQSE VEVLDDGFKW  120
RKYGKKMVKN SPNPRNYYKC SADGCPVKKR VERDRDDPSF VITTYEGFHN HSSMN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-26104171774Probable WRKY transcription factor 4
2lex_A2e-26104171774Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676750094
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596728.12e-95PREDICTED: probable WRKY transcription factor 50
RefseqXP_022561792.12e-95probable WRKY transcription factor 50
RefseqXP_022561862.12e-95probable WRKY transcription factor 50
SwissprotQ8VWQ52e-87WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A078IRM86e-94A0A078IRM8_BRANA; BnaC07g49530D protein
TrEMBLA0A0D3DCP26e-94A0A0D3DCP2_BRAOL; Uncharacterized protein
TrEMBLA0A3P6E4Y56e-94A0A3P6E4Y5_BRAOL; Uncharacterized protein
STRINGBo7g095430.11e-94(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.11e-70WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D
    DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro.
    Plant Methods, 2010. 6: p. 25
    [PMID:21108821]