PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676749906
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family Dof
Protein Properties Length: 276aa    MW: 29654.7 Da    PI: 9.9601
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676749906genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.11.9e-381472361
     zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
               e alkcprCds ntkfCyynny+l+qPr+fCk+CrryWt+GGalrnvPvGgg+r+n k+
  676749906 14 EGALKCPRCDSINTKFCYYNNYNLTQPRHFCKSCRRYWTRGGALRNVPVGGGCRRNSKK 72
               5689***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-30168IPR003851Zinc finger, Dof-type
PfamPF027011.1E-321671IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5341771IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101955IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MAERARQAKA PPPEGALKCP RCDSINTKFC YYNNYNLTQP RHFCKSCRRY WTRGGALRNV  60
PVGGGCRRNS KKGKNGNSKS SSSSSKQSSS TANAPSSSSG QLRTNHQFPF LPTLHNLTQL  120
GGIGLNLAAT NGNNQAHQIG SSLMNDLGFL HVGNGRNTLA PITGNINDNN NNGENSLMAS  180
AGSLSQFALF DPTSGLYAFQ NEGNIGNNVG ISFSSTSMVD SRAYQAAPVK MEDQTNLVNL  240
SRPVSSLTSP GNQTTQYFWN NSDFSGPSSN DHHQLL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). Involved in the regulation of root development (PubMed:23057675). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Element of a regulatory network controlling indole glucosinolates (IGS) biosynthesis, probably by inducing the expression of accurate genes (e.g. CYP83B1). Promotes apical dominance (PubMed:16740150). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:16740150, ECO:0000269|PubMed:23057675, ECO:0000269|PubMed:30626969}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap676749906
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA) (PubMed:10758484). Induced transiently in response to the generalist herbivore S.littoralis. Triggered by methyl jasmonate (MeJA) and wounding (PubMed:16740150). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:16740150}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006417783.11e-167dof zinc finger protein DOF1.1 isoform X2
RefseqXP_024009023.11e-166dof zinc finger protein DOF1.1 isoform X1
SwissprotQ8L9V61e-141DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLV4MVE91e-165V4MVE9_EUTSA; Uncharacterized protein
STRINGXP_006417783.11e-166(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.11e-129Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]