PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676746744
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 197aa    MW: 22916.4 Da    PI: 6.0844
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676746744genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.29.4e-30105163159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYG+K+++g++fpr+Y++C+ ++C vkkk++r++++p++v +tYeg+Hnh+
  676746744 105 LDDGYKWRKYGKKPITGNQFPRHYHKCSNPNCIVKKKIQRDTDNPEYVLTTYEGRHNHP 163
                59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-2797165IPR003657WRKY domain
PROSITE profilePS5081127.473100165IPR003657WRKY domain
SuperFamilySSF1182903.01E-25101165IPR003657WRKY domain
SMARTSM007749.6E-31105164IPR003657WRKY domain
PfamPF031064.1E-22106163IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MNYPLNMSPS FTDFDETFKF EDYDDDVFQM IMEDFSLEDH SPTMSWTSSE KLLATDVTSP  60
LQTSLATSPM SLEIGDKNAT KKRKRHKDDQ IIHVFKTKTP EENALDDGYK WRKYGKKPIT  120
GNQFPRHYHK CSNPNCIVKK KIQRDTDNPE YVLTTYEGRH NHPSPSVVYC DLDDFDFTSP  180
NTLSFQTRTY SYSHSAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-22991661178Probable WRKY transcription factor 4
2lex_A2e-22991661178Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00270DAPTransfer from AT2G21900Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676746744
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931600.0KM593160.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY92) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018438381.11e-115PREDICTED: probable WRKY transcription factor 59
SwissprotQ9SJ092e-83WRK59_ARATH; Probable WRKY transcription factor 59
TrEMBLV4NIM61e-111V4NIM6_EUTSA; Uncharacterized protein
STRINGXP_006404643.11e-112(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM138351726
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21900.11e-85WRKY DNA-binding protein 59