PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676745960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 565aa    MW: 61842.6 Da    PI: 5.9572
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676745960genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.58.9e-31179236260
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                dDgynWrKYGqK vkgse+prsYY+Ct+++C+vkkkvers+ +++++ei+Y   Hnh+k
  676745960 179 DDGYNWRKYGQKLVKGSEYPRSYYKCTQPNCEVKKKVERSR-EGHITEIIYAKVHNHPK 236
                8****************************************.***************85 PP

2WRKY99.52e-31372429259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                +Dgy+WrKYGqK+vkg+++prsYY+Ct +gC v+k+ver+++d + v +tY g+H+he
  676745960 372 EDGYRWRKYGQKVVKGNPNPRSYYKCTANGCIVTKHVERASDDLTSVLTTYIGKHTHE 429
                8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.4E-27171237IPR003657WRKY domain
SuperFamilySSF1182905.89E-25173237IPR003657WRKY domain
PROSITE profilePS5081123.273173237IPR003657WRKY domain
SMARTSM007741.5E-32178236IPR003657WRKY domain
PfamPF031062.2E-23179235IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.2E-34356431IPR003657WRKY domain
SuperFamilySSF1182909.42E-28363431IPR003657WRKY domain
PROSITE profilePS5081134.176366431IPR003657WRKY domain
SMARTSM007742.7E-35371430IPR003657WRKY domain
PfamPF031066.0E-24372429IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009555Biological Processpollen development
GO:0009846Biological Processpollen germination
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MAGFIDNFAV MGEWVDCSPN HKKRPKAELD REIFLQEDTK NKGFFQTSFQ EKPCYSRGGL  60
SERIAARAGF NVPSINTESI LRSSCLTISS PGVSPAALLE SPVFLSNPLS SPTTGKLLSL  120
PSDHKAKDEL FDDIATSLPF QAIATRSVDP TVEPDDSQAY EQTHDSGLED SMSSCTPADD  180
GYNWRKYGQK LVKGSEYPRS YYKCTQPNCE VKKKVERSRE GHITEIIYAK VHNHPKPPPN  240
RRSGIGSSGT GNDMQIDGTE QEGFAGTNEN IEWTSPVSAE LLYGSHSGSM QVQSGTQFGY  300
GDTGSDAFFK DEDGEDRTSH MSVSFGYNVE VDESEPKRRK IEAYATEMSG SSRATREPKV  360
VVQTTSDIDI LEDGYRWRKY GQKVVKGNPN PRSYYKCTAN GCIVTKHVER ASDDLTSVLT  420
TYIGKHTHEV PAARNSSHVN SGSSGTLQGG FATQTHNQYP VPHCISEGLI TANSSLFDFQ  480
PHMKPPSTGF SVYGGQTELS DLSMSGLAIG QERFPGLAAP AIGDPAGLML QFAAEPKVEP  540
VSQHELGLSR SSLIYRDIMS RLPHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-30179432878Probable WRKY transcription factor 4
2lex_A2e-30179432878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap676745960
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006413182.10.0probable WRKY transcription factor 34
SwissprotO655900.0WRK34_ARATH; Probable WRKY transcription factor 34
TrEMBLV4LVG80.0V4LVG8_EUTSA; Uncharacterized protein
STRINGXP_006413182.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM141811524
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26440.10.0WRKY DNA-binding protein 34
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Hu X, et al.
    Proteasome-mediated degradation of FRIGIDA modulates flowering time in Arabidopsis during vernalization.
    Plant Cell, 2014. 26(12): p. 4763-81
    [PMID:25538183]
  3. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]