PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676744138
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 323aa    MW: 36362.4 Da    PI: 9.5113
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676744138genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.12.9e-31134191259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                +DgynWrKYGqK+vkgse+prsY+rCt+++C +kkkve+s   ++++ei+Y+g+Hnh 
  676744138 134 EDGYNWRKYGQKQVKGSENPRSYFRCTYPNCLTKKKVETSLVKGHITEIVYRGSHNHA 191
                7********************************************************7 PP

2WRKY102.81.9e-32254312159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+ +d k v++tYeg+Hnh+
  676744138 254 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFTGCCVRKQVERAYQDAKSVITTYEGKHNHH 312
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-26127193IPR003657WRKY domain
PROSITE profilePS5081122.997128193IPR003657WRKY domain
SuperFamilySSF1182901.31E-24130193IPR003657WRKY domain
SMARTSM007741.8E-33133192IPR003657WRKY domain
PfamPF031064.9E-23134190IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.4E-36239314IPR003657WRKY domain
SuperFamilySSF1182901.27E-28246314IPR003657WRKY domain
PROSITE profilePS5081136.15249314IPR003657WRKY domain
SMARTSM007742.7E-36254313IPR003657WRKY domain
PfamPF031061.4E-24255312IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070370Biological Processcellular heat acclimation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGSFNQQRSV PKFKSAIPSP LPLSSSSHYF SMPPGLTHAD LLDSPLLFTS SNILPSPTTG  60
TFPAQSLNWK NNRLLTDQDE IQPEDVVEKF DFSFTSNRTS PPLFLPSTVA QPLPQLDVPN  120
SESRSSHTGN QTSEDGYNWR KYGQKQVKGS ENPRSYFRCT YPNCLTKKKV ETSLVKGHIT  180
EIVYRGSHNH AKPLSTKRSA PTAETNNGKS HQSSSHGDDQ EIGDDEAGAK RWKREETVKE  240
PRVVVQTASD IDILDDGYRW RKYGQKVVKG NPNPRSYYKC TFTGCCVRKQ VERAYQDAKS  300
VITTYEGKHN HHVPTQRRCH TST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-33134314877Probable WRKY transcription factor 4
2lex_A4e-33134314877Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY25 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250|UniProtKB:Q9SI37, ECO:0000269|PubMed:21336597}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00494DAPTransfer from AT5G07100Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676744138
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (PubMed:11449049). Induced by heat stress (PubMed:21336597). {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:21336597}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002871249.11e-173probable WRKY transcription factor 26 isoform X1
SwissprotQ9C5T31e-163WRK26_ARATH; Probable WRKY transcription factor 26
TrEMBLD7LZX61e-172D7LZX6_ARALL; WRKY DNA-binding protein 26
STRINGfgenesh1_pm.C_scaffold_60005451e-173(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM152911518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07100.11e-158WRKY DNA-binding protein 26
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]