PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676741292
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 497aa    MW: 55018.2 Da    PI: 8.2903
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676741292genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.53.8e-30130188160
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                ++DgynWrKYGqK vkg+ef rsYYrCt+++C++kk++ers+  +++v+++Y geH+h+k
  676741292 130 MEDGYNWRKYGQKLVKGNEFVRSYYRCTHPNCKAKKQLERSS-GGHIVDTVYFGEHDHPK 188
                58****************************************.***************85 PP

2WRKY106.11.8e-33303361159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ++Dgy+WrKYGqK+vkgs++prsYYrC+s+gCpvkk+vers++d++++++tYeg+H+h+
  676741292 303 VNDGYRWRKYGQKSVKGSPYPRSYYRCSSSGCPVKKHVERSSHDTNLLITTYEGKHDHD 361
                58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.527125189IPR003657WRKY domain
SuperFamilySSF1182901.14E-24126189IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-26127189IPR003657WRKY domain
SMARTSM007741.6E-34130188IPR003657WRKY domain
PfamPF031061.9E-23131187IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.2E-34290363IPR003657WRKY domain
SuperFamilySSF1182907.98E-29297363IPR003657WRKY domain
PROSITE profilePS5081134.486298363IPR003657WRKY domain
SMARTSM007748.4E-39303362IPR003657WRKY domain
PfamPF031062.7E-26304360IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 497 aa     Download sequence    Send to blast
MAEVGKVMAG DMELANSSET KPVDVVATDK MEATPVTIVT KTESVVQGCE TKECSNEIPE  60
STDSKKQLLL PESTDSKKQL QLVPFTKASV SEDEDVTPEK APKVPESSST VLSLQSGSEG  120
SSPFIREKVM EDGYNWRKYG QKLVKGNEFV RSYYRCTHPN CKAKKQLERS SGGHIVDTVY  180
FGEHDHPKPL GGAVPINHDR RSDVLVAVSK EKASGSIVQT HRQTESPKNH RGLHVSIVPS  240
ADDVKTAVSQ ASRIKGDNTH KEINSPVAKR RKKGGGNIEP ISMERSNNDS RNVVHTQTLF  300
DIVNDGYRWR KYGQKSVKGS PYPRSYYRCS SSGCPVKKHV ERSSHDTNLL ITTYEGKHDH  360
DMPPGRIVTH NNTLDSEVDD KEPSAKDTEV NKTPQSSALQ TITKDQHVED HSRKKAKTNG  420
FEKSLDKGPA LDAKPKEEIK DRSDVTKDHA ANHVKSEIKS EPKPEPKSDD KTIVCHENTA  480
RTVESHEQKP KAESGQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A6e-47129365176WRKY transcription factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Binds to a 5'-CGTTGACCGAG-3' consensus core sequence which contains a W box, a frequently occurring elicitor-responsive cis-acting element. {ECO:0000269|PubMed:8972846}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676741292
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:17264121}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006418534.10.0WRKY transcription factor 1
SwissprotQ9SI370.0WRKY1_ARATH; WRKY transcription factor 1
TrEMBLE4MX100.0E4MX10_EUTHA; mRNA, clone: RTFL01-10-D23
TrEMBLV4L0100.0V4L010_EUTSA; Uncharacterized protein
STRINGXP_006418533.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79492639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.20.0zinc-dependent activator protein-1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Qiao Z,Li CL,Zhang W
    WRKY1 regulates stomatal movement in drought-stressed Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 91(1-2): p. 53-65
    [PMID:26820136]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]