PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676738304
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family NF-YC
Protein Properties Length: 195aa    MW: 22019.6 Da    PI: 8.4219
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676738304genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC48.32.2e-15901771299
      NF-YC  12 katdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                 ++d k  ++P+ ri++i+++d+   +i  +a  l+ ka e+fi  ++  ++  + + k++ ++   ++++v++ + ++fl d vp++
  676738304  90 GVEDAKMFRFPMNRIRRIMRSDNSAPQIMQDAVFLVNKATEMFIERFSEEAYETSVQDKKKFIHYKHLSSVVSNDERYEFLADCVPEK 177
                56789999*****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471138.98E-2097176IPR009072Histone-fold
PfamPF008081.1E-2198161IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.2E-2499176IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MVSSKKPKSD GVNKAGGRNT RSSGPKTKKN TANKMNSKGI AKKEPEVYEI SESSSSDSVE  60
EARRDEPNGV VVSKDRNGRR KNGEEEDGGG VEDAKMFRFP MNRIRRIMRS DNSAPQIMQD  120
AVFLVNKATE MFIERFSEEA YETSVQDKKK FIHYKHLSSV VSNDERYEFL ADCVPEKLKA  180
EVALEEWERG MTDVG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0252661e-106BT025266.1 Arabidopsis thaliana At1g07980 mRNA, complete cds.
GenBankAY0868151e-106AY086815.1 Arabidopsis thaliana clone 28026 mRNA, complete sequence.
GenBankAK2292661e-106AK229266.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-54-O22.
GenBankAK2290111e-106AK229011.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-31-C07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010488220.13e-91PREDICTED: DNA polymerase epsilon subunit 4
TrEMBLA0A087HLV74e-91A0A087HLV7_ARAAL; Uncharacterized protein
STRINGBra018668.1-P5e-86(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.14e-67nuclear factor Y, subunit C10