PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676734870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 222aa    MW: 24989.7 Da    PI: 9.2124
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676734870genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.81.9e-32148205158
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+Hnh
  676734870 148 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKRVERLSEDCRMVITTYEGRHNH 205
                59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.6E-34133205IPR003657WRKY domain
SuperFamilySSF1182901.7E-28140205IPR003657WRKY domain
PROSITE profilePS5081129.585143205IPR003657WRKY domain
SMARTSM007741.3E-37148207IPR003657WRKY domain
PfamPF031063.3E-25149205IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MEGGGRRVVI NNYDLQQVTS SSTTIQENMN FLVPFEETNV LTFFSSSSSS SSLSSPSFPI  60
HNSSSTINTT HAPLGFSKNL QGGVGPLGSK VVNDDQDSIR GGINNDAHSN SWWRSSSGSG  120
EMKNKVKIRR KLREPRFCFQ TKSDVDVLDD GYKWRKYGQK VVKNSLHPRS YYRCTHNNCR  180
VKKRVERLSE DCRMVITTYE GRHNHIPSDD STSPDHDCLS SF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-26139205874Probable WRKY transcription factor 4
2lex_A1e-26139205874Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126132KIRRKLR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676734870
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4048570.0AF404857.1 Arabidopsis thaliana WRKY transcription factor 12 (WRKY12) mRNA, complete cds.
GenBankBT0289920.0BT028992.1 Arabidopsis thaliana At2g44745 mRNA, complete cds.
GenBankDQ4466220.0DQ446622.1 Arabidopsis thaliana clone pENTR221-At2g44745 WRKY family transcription factor (At2g44745) mRNA, complete cds.
GenBankDQ6530580.0DQ653058.1 Arabidopsis thaliana clone 0000017096_0000011985 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881979.11e-134probable WRKY transcription factor 12
SwissprotQ93WY41e-135WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A178VP121e-133A0A178VP12_ARATH; WRKY12
STRINGfgenesh2_kg.4__2664__AT2G44745.11e-134(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60452546
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.11e-122WRKY family protein
Publications ? help Back to Top
  1. Yu Y, et al.
    MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering.
    Plant Sci., 2013. 212: p. 1-9
    [PMID:24094048]
  2. Yang L, et al.
    PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa.
    Sci Rep, 2016. 6: p. 18643
    [PMID:26819184]
  3. Li W,Wang H,Yu D
    Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
    Mol Plant, 2016. 9(11): p. 1492-1503
    [PMID:27592586]
  4. Han Y, et al.
    WRKY12 represses GSH1 expression to negatively regulate cadmium tolerance in Arabidopsis.
    Plant Mol. Biol., 2019. 99(1-2): p. 149-159
    [PMID:30617455]