PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676733992
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family CO-like
Protein Properties Length: 308aa    MW: 33589.7 Da    PI: 7.0326
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676733992genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box29.61.4e-09448442
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
               r C+ +++  ++l+C+ +  +lC +C  ++H        H++v+l
  676733992  4 RLCDSCKSAVATLYCRADAAFLCGECDGKIHTAnklasrHERVSL 48
               68*****************************55788888998875 PP

2zf-B_box26.71.1e-084791442
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                 C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  676733992 47 SLCEVCEQAPAHVTCKADAAALCVTCDRDIHSAnplsrrHERVPV 91
               68*****************************66899999*99986 PP

3CCT68.81.4e-23242285144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++
  676733992 242 REARVLRYREKRKNRKFEKTIRYASRKAYAEVRPRIKGRFAKRT 285
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003367.1E-16148IPR000315B-box-type zinc finger
PROSITE profilePS5011910.836148IPR000315B-box-type zinc finger
PfamPF006436.0E-8448IPR000315B-box-type zinc finger
CDDcd000213.89E-8448No hitNo description
PROSITE profilePS5011911.2064491IPR000315B-box-type zinc finger
PfamPF006436.9E-74791IPR000315B-box-type zinc finger
CDDcd000218.44E-94891No hitNo description
SMARTSM003361.1E-104991IPR000315B-box-type zinc finger
PROSITE profilePS5101716.618242284IPR010402CCT domain
PfamPF062032.1E-17242284IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010161Biological Processred light signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MASRLCDSCK SAVATLYCRA DAAFLCGECD GKIHTANKLA SRHERVSLCE VCEQAPAHVT  60
CKADAAALCV TCDRDIHSAN PLSRRHERVP VTPFYDAAHG RSSAAAKSAS STNFLEEDAD  120
VTMEAASWLL PNPSIKEGVE IQNLFSDLDY SAMDPKMETS ENSSGNDGVV PVQNKAMFLN  180
EDYFNFDMSA SKTTFPLGLS CVNQTVSSTS LDVALVPETE ISNTTTTVTT TTPAVQLTPA  240
EREARVLRYR EKRKNRKFEK TIRYASRKAY AEVRPRIKGR FAKRTDSRVN DGGGDVGVYG  300
GFGVVPSF
Cis-element ? help Back to Top
SourceLink
PlantRegMap676733992
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006405043.10.0zinc finger protein CONSTANS-LIKE 3
SwissprotQ9SK531e-148COL3_ARATH; Zinc finger protein CONSTANS-LIKE 3
TrEMBLV4NJM40.0V4NJM4_EUTSA; Uncharacterized protein
STRINGXP_006405043.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27602765
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.11e-143CONSTANS-like 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Tripathi P,Carvallo M,Hamilton EE,Preuss S,Kay SA
    Arabidopsis B-BOX32 interacts with CONSTANS-LIKE3 to regulate flowering.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(1): p. 172-177
    [PMID:27999181]