PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676733416
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family CO-like
Protein Properties Length: 373aa    MW: 41184.1 Da    PI: 6.2618
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676733416genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box216.8e-07649340
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
               e+kC+++   ++ ++C+++   lC +C ++ H+       Ht++
  676733416  6 EPKCDHCATVQAVIYCKSDLARLCLNCDVHVHSAnplsrrHTRS 49
               789******88*********************667888889876 PP

2CCT62.41.4e-21316359144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                R++a+lRYkeK+ +R F K+irY+sRKa+A++R+RvKGrFvk+ 
  676733416 316 RNEAKLRYKEKKLKRTFGKQIRYASRKARADTRKRVKGRFVKAG 359
                99***************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.5E-9451IPR000315B-box-type zinc finger
PfamPF006434.0E-5649IPR000315B-box-type zinc finger
CDDcd000214.97E-5751No hitNo description
PROSITE profilePS501198.546951IPR000315B-box-type zinc finger
PfamPF062035.1E-16316358IPR010402CCT domain
PROSITE profilePS5101714.436316358IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MSQTIEPKCD HCATVQAVIY CKSDLARLCL NCDVHVHSAN PLSRRHTRSL ICDKCFSQPG  60
VIRCLDEKVS NCQGCHWHAS NCSSLGHKIQ TLNPFSGCPS PAEYVRMWSS ILELSVSGLV  120
NPLPGSLPLN DPNNSMFEMT NINELDGLIS SSYSMMPHNI SYTQTLSDQS SFFSLDSKGC  180
PDLVLKLEEE EEDLCEGLNL DNAPLNFDVG DDIIGCSPQE HIESQYTATS RGQQDCTSYH  240
QSGPLQMNNN SGLSLPLPAS HGLLGQIHPT MSLTISNITG HESNAADYQD CGLSAGFIMS  300
DSPWESNLEV ASPQARNEAK LRYKEKKLKR TFGKQIRYAS RKARADTRKR VKGRFVKAGD  360
NYDYDPSSPT TNH
Cis-element ? help Back to Top
SourceLink
PlantRegMap676733416
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406230.20.0zinc finger protein CONSTANS-LIKE 12
SwissprotQ9LJ440.0COL12_ARATH; Zinc finger protein CONSTANS-LIKE 12
TrEMBLV4M5W20.0V4M5W2_EUTSA; Uncharacterized protein
STRINGXP_006406230.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53192240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21880.11e-165B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. OrdoƱez-Herrera N, et al.
    The Transcription Factor COL12 Is a Substrate of the COP1/SPA E3 Ligase and Regulates Flowering Time and Plant Architecture.
    Plant Physiol., 2018. 176(2): p. 1327-1340
    [PMID:29187570]