PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676733102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family CO-like
Protein Properties Length: 408aa    MW: 45956.7 Da    PI: 5.2929
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676733102genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box254e-081457340
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
               +r C+ + + +++++C  ++ +lC++C  + H+       H++v
  676733102 14 ARACDSCVKRRARWYCAADDAFLCHSCDGSVHSAnplarrHERV 57
               578*****************************657888888876 PP

2CCT68.51.8e-23359402144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  676733102 359 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS 402
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.0E-101259IPR000315B-box-type zinc finger
PROSITE profilePS5011910.7511259IPR000315B-box-type zinc finger
PfamPF006431.8E-61457IPR000315B-box-type zinc finger
CDDcd000211.35E-81559No hitNo description
PfamPF062035.3E-18359401IPR010402CCT domain
PROSITE profilePS5101716.083359401IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MMKSLANAVG GKTARACDSC VKRRARWYCA ADDAFLCHSC DGSVHSANPL ARRHERVRLK  60
SASAGKHRHA SSSPPHPATW HQGFTRKART PRGGKKSHSM VFHDLVPEMS SEDQNYEVEE  120
QLIFEVPVLN PMVDEQCLNE SVETKIEFPM MPVCFKSSDE EDDNAESCLN GLFPTDMELA  180
QFSADVEILL GGGTDREFHA IEELGLGEML KIEKEEVEEE EEMATREVCD LDVSDETSPF  240
EISFDYDCSH KIAFDKEEED GKEDVMKNVM AVGVNEMSGR IKEEKKEKVL MLSLDYEAVI  300
STWGGQGTPW SALEPPDLDL DMLCCPIDSM GDESGVEAHH HNHFRGLGLH MGEAGDGGRE  360
ARVSRYREKR RTRLFSKKIR YEVRKLNAEK RPRMKGRFVK RSSIAAAH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1369385RRTRLFSKKIRYEVRKL
Cis-element ? help Back to Top
SourceLink
PlantRegMap676733102
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009105042.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like
RefseqXP_013649118.10.0zinc finger protein CONSTANS-LIKE 6-like
SwissprotQ8LG760.0COL6_ARATH; Zinc finger protein CONSTANS-LIKE 6
TrEMBLA0A397YP880.0A0A397YP88_BRACM; Uncharacterized protein
STRINGXP_010415472.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.10.0B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]