PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676730990
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 141aa    MW: 16503.6 Da    PI: 9.848
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676730990genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.21.4e-3262120159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK vk+++fprsYY+Ct++gC+vkk+v+r + d+ vv++tY+g H+h+
  676730990  62 LDDGYRWRKYGQKAVKNNPFPRSYYKCTQEGCRVKKQVQRLSGDEGVVVTTYQGVHTHP 120
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-3447121IPR003657WRKY domain
SuperFamilySSF1182902.62E-2954121IPR003657WRKY domain
PROSITE profilePS5081130.68757122IPR003657WRKY domain
SMARTSM007748.5E-3862121IPR003657WRKY domain
PfamPF031062.0E-2663120IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006817Biological Processphosphate ion transport
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MEDMSCQVLF PCSSSSVDHR LSGDQAQRAA QTKEEDKRKD NKKKKEREPR FAFQTRSRVD  60
ILDDGYRWRK YGQKAVKNNP FPRSYYKCTQ EGCRVKKQVQ RLSGDEGVVV TTYQGVHTHP  120
VEKPSDNFHH ILTQMHIFPP F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-2852119774Probable WRKY transcription factor 4
2lex_A4e-2852119774Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00325DAPTransfer from AT3G01970Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676730990
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2465801e-133KC246580.1 Brassica napus WRKY transcription factor 45.1 (WRKY45.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018486951.12e-75PREDICTED: probable WRKY transcription factor 45
SwissprotQ9S7639e-68WRK45_ARATH; Probable WRKY transcription factor 45
TrEMBLA0A087H6A04e-77A0A087H6A0_ARAAL; Uncharacterized protein
STRINGA0A087H6A07e-78(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01970.18e-69WRKY DNA-binding protein 45
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Chen L,Xiang S,Chen Y,Li D,Yu D
    Arabidopsis WRKY45 Interacts with the DELLA Protein RGL1 to Positively Regulate Age-Triggered Leaf Senescence.
    Mol Plant, 2017. 10(9): p. 1174-1189
    [PMID:28735023]