PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676730982
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family CO-like
Protein Properties Length: 359aa    MW: 39639.8 Da    PI: 5.8923
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676730982genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.21.3e-061559442
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
               r C+++ +   + +Ce ++ +lC +C    H+       H++vp+
  676730982 15 RACDTCRSAACTVYCEADSAYLCTTCDARVHSAnhvasqHERVPV 59
               57******99********************966888888888875 PP

2zf-B_box322.5e-1057102342
   zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                 ++C+ +e+ ++ + C+ +   lC  C  e+H+       H++vp+
  676730982  57 VPVCQSCESSPAAFLCKADAASLCTACDAEIHSAnplarrHQRVPI 102
                689*****************************66899999**9997 PP

3CCT67.63.4e-23289331143
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                Rea++lRY+eK+ktRkFeK+irY+sRKa+Ae RpR+KGrF+k+
  676730982 289 REARVLRYREKKKTRKFEKTIRYASRKAYAEIRPRIKGRFAKR 331
                9****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011911.3621259IPR000315B-box-type zinc finger
SMARTSM003362.1E-91259IPR000315B-box-type zinc finger
CDDcd000212.65E-81559No hitNo description
PROSITE profilePS5011911.53355102IPR000315B-box-type zinc finger
PfamPF006433.5E-856102IPR000315B-box-type zinc finger
CDDcd000212.38E-858102No hitNo description
SMARTSM003365.2E-1160102IPR000315B-box-type zinc finger
PROSITE profilePS5101716.42289331IPR010402CCT domain
PfamPF062037.3E-17289331IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MLKEESNESG GTWARACDTC RSAACTVYCE ADSAYLCTTC DARVHSANHV ASQHERVPVC  60
QSCESSPAAF LCKADAASLC TACDAEIHSA NPLARRHQRV PILPISPNSC SSMATDADNN  120
GMVVGEEDDE NEDDREVASW LMLNPGKDTN NHNNGFLFGV EYLDLVDYTS SMDSQFGDQY  180
SQHQKSFGGE DGVVPLQVEQ STSHLQQSKH NNFHLGINYG CSTGAHYNYN GSLKNLNHTV  240
SVSSTDISVV PESTASDTTV QHPRTPKETT DQLSGPPNQM VQQLSPMDRE ARVLRYREKK  300
KTRKFEKTIR YASRKAYAEI RPRIKGRFAK RIEIEADAEQ LFSTSLMSNT TGYGIVPSF
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. Does not affect flowering time.
Cis-element ? help Back to Top
SourceLink
PlantRegMap676730982
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at dawn.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010485482.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2
SwissprotQ965020.0COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLI3RT180.0I3RT18_ARALL; Putative flowering-time constans protein
STRINGXP_010485482.10.0(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21282670
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.10.0CONSTANS-like 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Simon S,Rühl M,de Montaigu A,Wötzel S,Coupland G
    Evolution of CONSTANS Regulation and Function after Gene Duplication Produced a Photoperiodic Flowering Switch in the Brassicaceae.
    Mol. Biol. Evol., 2015. 32(9): p. 2284-301
    [PMID:25972346]