PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676729154
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 397aa    MW: 44317.9 Da    PI: 6.7219
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676729154genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY955.2e-30167224260
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                +Dgy WrKYGqK+vk+se+prsY++Ct+++C +kk ve+++ d++++ei+Y+g Hnh+k
  676729154 167 NDGYGWRKYGQKQVKKSENPRSYFKCTYPNCVSKKIVETAS-DGQITEIIYKGGHNHPK 224
                8***************************************9.***************85 PP

2WRKY1031.7e-32333389359
                -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                Dg++WrKYGqK+vkg+++prsYY+Ct++gC v+k+versaed+++v +tYeg+Hnh+
  676729154 333 DGFRWRKYGQKVVKGNTNPRSYYKCTYQGCGVRKQVERSAEDERAVLTTYEGRHNHD 389
                9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.9E-25154225IPR003657WRKY domain
SuperFamilySSF1182904.71E-23163225IPR003657WRKY domain
SMARTSM007741.3E-30166224IPR003657WRKY domain
PROSITE profilePS5081120.461167225IPR003657WRKY domain
PfamPF031061.7E-22167223IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.8E-34316391IPR003657WRKY domain
SuperFamilySSF1182902.22E-28323391IPR003657WRKY domain
PROSITE profilePS5081134.176326391IPR003657WRKY domain
SMARTSM007749.8E-38331390IPR003657WRKY domain
PfamPF031061.6E-25333389IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MSSTSFTDLL ASSGVDCYEE DEDFRVSGSV SLYQNGGFYP ERTGSVLPKF KSAQPPPLPI  60
SPSSLGFAFS DLLDSPLLLS SSHSLISPTT GAFPFQGLNG TNSHSDFPWQ LQSQSQPSNV  120
SSALQETYAV QDLPKKQEPV PREFAAHSFG SDRQVKVPSY MVSRNSNDGY GWRKYGQKQV  180
KKSENPRSYF KCTYPNCVSK KIVETASDGQ ITEIIYKGGH NHPKPEFTKR PSGSTSISSS  240
SANARRVFNP SSVVVNEAHD QSENSSISFD YSDLEQKSFK SEYGEIEEEE EQPEMKRLKR  300
EGEDEGMSVE VSRGVKEPRV VVQTLSDIDV LIDGFRWRKY GQKVVKGNTN PRSYYKCTYQ  360
GCGVRKQVER SAEDERAVLT TYEGRHNHDV PTALRRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-32322391877Probable WRKY transcription factor 4
2lex_A4e-32322391877Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Functions with WRKY33 as positive regulator of salt stress response and abscisic acid (ABA) signaling (PubMed:18839316). Plays a partial role in heat stress tolerance (PubMed:19125253). Functions with WRKY26 and WRKY33 as positive regulator of plant thermotolerance by partially participating in ethylene-response signal transduction pathway (PubMed:21336597). {ECO:0000250|UniProtKB:Q9SI37, ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:19125253, ECO:0000269|PubMed:21336597}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00282DAPTransfer from AT2G30250Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676729154
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt stress (PubMed:18839316). Induced by heat stress (PubMed:19125253). {ECO:0000269|PubMed:18839316, ECO:0000269|PubMed:19125253}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529340.0AK352934.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-12-D15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410139.10.0probable WRKY transcription factor 25
SwissprotO229210.0WRK25_ARATH; Probable WRKY transcription factor 25
TrEMBLA0A087FWF30.0A0A087FWF3_ARAAL; Uncharacterized protein
STRINGA0A087FWF30.0(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116031733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30250.10.0WRKY DNA-binding protein 25
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]