PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676728644
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family CO-like
Protein Properties Length: 368aa    MW: 40188.2 Da    PI: 5.2887
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676728644genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.91.5e-06444539
   zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
               +C+ ++e++   +C+++  +lC +C  + H+       H++
  676728644  4 MCDFCGEQRSMVYCRSDAACLCLSCDRSVHSAnalskrHSR 44
               6*****************************65677777776 PP

2zf-B_box24.46.1e-084694441
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg...........Htvvp 41
                +C++++ ++++  C + ++ lC++C  ++H++           H++++
  676728644 46 LICERCNAQPATVRCVEERVSLCQNCDWSGHNNnnsssssssnnHKRQT 94
               68*****************************888888888888888765 PP

3CCT60.46e-21311354144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                R++a++RYkeK+k RkF+K++rY+sRKa+A+ R RvKGrFvk+ 
  676728644 311 RNNAVMRYKEKKKARKFDKRVRYASRKARADVRRRVKGRFVKAG 354
                99***************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.897147IPR000315B-box-type zinc finger
CDDcd000214.21E-8447No hitNo description
SMARTSM003362.5E-9447IPR000315B-box-type zinc finger
PROSITE profilePS501199.0584395IPR000315B-box-type zinc finger
CDDcd000218.89E-64776No hitNo description
SMARTSM003360.664895IPR000315B-box-type zinc finger
PROSITE profilePS5101715.338311353IPR010402CCT domain
PfamPF062031.0E-15311353IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MGYMCDFCGE QRSMVYCRSD AACLCLSCDR SVHSANALSK RHSRTLICER CNAQPATVRC  60
VEERVSLCQN CDWSGHNNNN SSSSSSSNNH KRQTISCYSG CPSSSELASI WSFCLDLAGQ  120
SGCEQELGMM NIDDDGQTNQ NCNEEDKKDV VVGSSSRPET SSAAPATSSF PKDVGVCEDD  180
FYGNLGMDEV DLALENYEEL FGTAFNPSGE LFGQGGIDSL FQKHQAAPEG GNSVQPAESN  240
DSFMSSKTEP IICFASKPAH SNISFSGVTG DSSAGDFQEC GASSSMQPSG EPPWFPQTSQ  300
DNNACSQSVT RNNAVMRYKE KKKARKFDKR VRYASRKARA DVRRRVKGRF VKAGEAYDYD  360
PLTPTRSY
Cis-element ? help Back to Top
SourceLink
PlantRegMap676728644
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3169340.0AK316934.1 Arabidopsis thaliana AT3G07650 mRNA, complete cds, clone: RAFL14-22-K23.
GenBankBT0294900.0BT029490.1 Arabidopsis thaliana At3g07650 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407812.10.0zinc finger protein CONSTANS-LIKE 9
SwissprotQ9SSE50.0COL9_ARATH; Zinc finger protein CONSTANS-LIKE 9
TrEMBLV4LFJ10.0V4LFJ1_EUTSA; Uncharacterized protein
STRINGXP_006407811.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16822786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07650.40.0CONSTANS-like 9