PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676726210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 662aa    MW: 71858.1 Da    PI: 5.7744
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676726210genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.41.1e-31280337260
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                +DgynWrKYGqK vkgse+prsYY+Ct ++C+vkkkvers+ +++++ei+Y+g Hnh+k
  676726210 280 EDGYNWRKYGQKLVKGSEYPRSYYKCTNPNCQVKKKVERSR-EGHITEIIYKGAHNHSK 337
                8****************************************.***************85 PP

2WRKY62.67e-20501533133
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT-- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCp 33 
                ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC 
  676726210 501 LDDGYRWRKYGQKVVKGNPNPRSYYKCTAPGCG 533
                59******************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.4E-28274338IPR003657WRKY domain
SuperFamilySSF1182904.71E-25277338IPR003657WRKY domain
SMARTSM007741.6E-34279337IPR003657WRKY domain
PROSITE profilePS5081123.25280338IPR003657WRKY domain
PfamPF031065.6E-24280335IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-21486533IPR003657WRKY domain
SuperFamilySSF1182901.44E-17493542IPR003657WRKY domain
PROSITE profilePS5081122.423496532IPR003657WRKY domain
SMARTSM007745.4E-14501554IPR003657WRKY domain
PfamPF031067.2E-14502533IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MSGFDENVAV MGEWVPRSPS PGTLFSSAIG QEKSSRRVLE RELSLNHGQV TGLEEDTTTG  60
NNNNKDSSQT NNSSRGGLRE RIAARAGFNT PKLNTQNIRS SNDFSSDSGL RSPCLTISSP  120
GLSPATLLES PVFLSNPLAQ PSPTTGKFPF LPGVNSNGLS SDKAKDEFFD DIGASFTFQP  180
VSRSSSSFFQ GATEMMPVDY GNFNNRSSHQ SPEDDAKLGS QNVESSNLYG IETEQSGLKR  240
KTSYATTNTT GLETVDHQEE EEEGEDQRRG DSMVGGAPAE DGYNWRKYGQ KLVKGSEYPR  300
SYYKCTNPNC QVKKKVERSR EGHITEIIYK GAHNHSKPLP NRRSGMQVDG TEPPEQQQQQ  360
QQQQQQRDCS ATWVNSNNTQ QQGGSNENNN EEGSTGFEYG NQSASIQAQT GGGQYESGDG  420
NGGVVVVDAS STFSNDEDED DRGTHGSVSL GYDGGRGGGE GDESESKRRK LEAYAAEMSG  480
ATRAIREPRV VVQTTSDVDI LDDGYRWRKY GQKVVKGNPN PRSYYKCTAP GCGGNGNSGV  540
SAAQTHHYHN GHHSEQPRGR FDRQLTVNSQ SPFGRPFSFQ PHLGPPSGYS FGLGQTGLAN  600
LSLPGLAFGQ GKLPVLPHPY MTQTVGGMSE AMMHRGMEPK VEPVSETGQS VYNQIMSRLP  660
QI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-21280533877Probable WRKY transcription factor 4
2lex_A9e-21280533877Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Regulates WOX8 and WOX9 expression and basal cell division patterns during early embryogenesis. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Required to repolarize the zygote from a transient symmetric state. {ECO:0000269|PubMed:21316593}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676726210
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006401355.10.0probable WRKY transcription factor 2
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLV4LSF00.0V4LSF0_EUTSA; Uncharacterized protein
STRINGXP_006401355.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79542740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Ueda M, et al.
    Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote.
    Genes Dev., 2017. 31(6): p. 617-627
    [PMID:28404632]
  4. Lei R, et al.
    Arabidopsis WRKY2 and WRKY34 transcription factors interact with VQ20 protein to modulate pollen development and function.
    Plant J., 2017. 91(6): p. 962-976
    [PMID:28635025]