PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676726056
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family bZIP
Protein Properties Length: 478aa    MW: 52836.7 Da    PI: 5.9225
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676726056genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.17.9e-08156218163
                XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                e+e +r rr   NRe+Ar   +R++a +eeL +k++ L+ eN+ L+ e +   ke ++l++ +
  676726056 156 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLTYENENLRREKDWALKEFQSLETIN 218
                78899*******************************************999999999988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-9156220IPR004827Basic-leucine zipper domain
PfamPF001703.6E-7156218IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.117158221IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.89E-6160215No hitNo description
Gene3DG3DSA:1.20.5.1709.5E-7160226No hitNo description
CDDcd147022.30E-12166212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MELEPISSCC SSSSSPSVPS STSSGEDAAN MTELEAAEAL ADLAQLAVMR EQVFESAASW  60
GSKGKRVRKR VKTESPPCDS RLKPADSETL PTPDLAEGRA VKEEEEDEVQ PSNTELTKVP  120
VKTEMNGETP KPNLASTLRC RSSGCGRSRQ NLSEAEREER RIRRILANRE SARQTIRRRQ  180
AMCEELSKKA ADLTYENENL RREKDWALKE FQSLETINKQ LKEQVSKSVK PETNEPEESP  240
TPSQVEMSTS STPFYFYNQS PYQLFCWPHV TQSSSPMVSP LETQNGFTAP FATSGGAPAK  300
IMTTQENGNT ADDNSQKTHF YVVPCPWFLP AHDQSNGVPF AFQDPQRVVS SNGHYIDDSS  360
AKPAEVTKSL RPHLPTSIKE EDSGSTEARP LYDLNESATE VLSEGGDGFP VTQQAFKFKH  420
EDVSDSPNGV TSMPPGHHVL TSLPGKKQGS LAAAEARKRR KELTKLKNLH GRQCRMQV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1456461RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMap676726056
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0998750.0AY099875.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
GenBankBT0003190.0BT000319.1 Arabidopsis thaliana unknown protein (At1g19490) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416500.20.0light-inducible protein CPRF2
TrEMBLV4L5160.0V4L516_EUTSA; Uncharacterized protein (Fragment)
STRINGXP_006416500.10.0(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.10.0bZIP family protein