PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676725914
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family M-type_MADS
Protein Properties Length: 406aa    MW: 46808.5 Da    PI: 6.7167
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676725914genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.57.6e-23953145
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
               kr e++ nrqvt+skR+ gilKKA+ELS+LCd+++ +++fs+tgk
  676725914  9 KRLESTGNRQVTYSKRKSGILKKAKELSILCDIDIVLLMFSPTGK 53
               6889***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.782161IPR002100Transcription factor, MADS-box
SMARTSM004323.4E-31160IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.33E-26288IPR002100Transcription factor, MADS-box
CDDcd002665.14E-27282No hitNo description
PRINTSPR004041.2E-18323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-191255IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MGRVKLKIKR LESTGNRQVT YSKRKSGILK KAKELSILCD IDIVLLMFSP TGKPTIFHGE  60
HSCIEEVISK FAQLTPQERT KRYDKSELIY FPRLQALKKT FKKLDHDVNI HEFLGARNQT  120
IENSLSHIVK VFVTLTTQQG LSNQVAIFQA QLMECHRRLS CWTNIDRIEN TEHLNLLEDS  180
LRKSIERIQI HKEHYGKNQL LPIECTTTQF HNGIQLPLAM GGNNSMQEAH SMSWLPDNGN  240
QQTILPGDSS FLPHREIDGS IPIYSNCFFE SIKQEDQLCS NPGQQFEQLE QQNDGCLGLQ  300
QIGEEYSYPT PFGTTLGMEE DQDKKIKTEM ELNNLQQQQQ QQQQQQQDPS SMYDPTASNS  360
GCFQIPHDQS IFATDHHNHH HHHHHHHQNW TPDSIFGQTS YNQQSN
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap676725914
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0941160.0AB094116.1 Arabidopsis thaliana At1g18750 mRNA for MADS-box protein, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013660239.10.0agamous-like MADS-box protein AGL65
SwissprotQ7X9I00.0AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A3P5YL320.0A0A3P5YL32_BRACM; Uncharacterized protein
STRINGBra031049.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.10.0AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]