PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676724330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family WRKY
Protein Properties Length: 285aa    MW: 32354.9 Da    PI: 7.4949
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676724330genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1092.3e-34141198259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp++v++tYeg+Hnh+
  676724330 141 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCNVKKRVERSFQDPSIVITTYEGKHNHP 198
                8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381302.1E-952285IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.801.1E-35125200IPR003657WRKY domain
SuperFamilySSF1182904.05E-30132200IPR003657WRKY domain
PROSITE profilePS5081132.879135200IPR003657WRKY domain
SMARTSM007743.9E-40140199IPR003657WRKY domain
PfamPF031069.7E-27141198IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MADQADHKNT SLEEKSFTTL TDCLQSSLVM DYNSLEKVFK FSPYSSPFQP ISASHMGQIV  60
NYPYLNINPN SPIVSSSSNE ADPKENLSDK SGPMEEDNEG DQYAGGESSK ELAKQGKAKG  120
EKKEREARIA FMTKTEIDHL EDGYRWRKYG QKAVKNSPYP RSYYRCTTQK CNVKKRVERS  180
FQDPSIVITT YEGKHNHPIP STLRGPVVAE HLLGHRGSGL LHSFPRHHQE FLMMNHRPVN  240
YQSGGSVSYE RSHHNSSYNN SNHQEVVDYG LLQDIVPSML LKHES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-30130201778Probable WRKY transcription factor 4
2lex_A7e-30130201778Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00168DAPTransfer from AT1G29860Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap676724330
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018463617.11e-160PREDICTED: probable WRKY transcription factor 71
SwissprotQ93WV41e-141WRK71_ARATH; WRKY transcription factor 71
TrEMBLA0A0A7RI881e-156A0A0A7RI88_BRAOC; WRKY70 protein
STRINGBo7g044930.11e-151(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM139111825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.11e-118WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Guo D, et al.
    The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis.
    Plant Cell, 2015. 27(11): p. 3112-27
    [PMID:26578700]
  2. Yu Y, et al.
    WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana.
    Plant J., 2016. 85(1): p. 96-106
    [PMID:26643131]
  3. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  4. Yu Y, et al.
    WRKY71 Acts Antagonistically Against Salt-Delayed Flowering in Arabidopsis thaliana.
    Plant Cell Physiol., 2018. 59(2): p. 414-422
    [PMID:29272465]