PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676723568
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family GeBP
Protein Properties Length: 371aa    MW: 40989.3 Da    PI: 7.5847
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676723568genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF5731345.5e-42148243297
     DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                +fqr+wseeDei+ LqGl+d+k++tg++p+dd++afy+ vkksisf+vsk+q++eK+r L+kK++++  k k+g+ep+fsk+hd+k+f+lsk++Wg
  676723568 148 YFQRVWSEEDEIAALQGLLDYKKDTGVNPYDDTNAFYQSVKKSISFDVSKTQVMEKLRGLRKKYENNLGKGKKGEEPTFSKPHDRKAFDLSKSVWG 243
                8**********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.0E-36149243IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MSGKRFNPLE DPPNASSSDE EDEVETTSLA DGEETDGNSS SEDEQVDERV LSKPEKQQVS  60
DSESGSGEET DTEKKHPVKK NPGSSVVKSV TGTKESVVTK KKQDSKKVKP LAKSSTKKRS  120
FSETDGAAAS TDAKKVKRSS GEETKKNYFQ RVWSEEDEIA ALQGLLDYKK DTGVNPYDDT  180
NAFYQSVKKS ISFDVSKTQV MEKLRGLRKK YENNLGKGKK GEEPTFSKPH DRKAFDLSKS  240
VWGADGMALD SAVKSNGKSK KSRKSSKKVE PVTQELASSS PNGKSCEDEV ANKGEASSIA  300
ELDAFVKSLA RFGVDDLSAQ QGWSRLASED KKRFEEQWKV LQLREFEFYS LKSGFLHEVV  360
TKMAEAFRPS P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638352.11e-158PREDICTED: mediator-associated protein 1
TrEMBLA0A0D3C9B91e-158A0A0D3C9B9_BRAOL; Uncharacterized protein
STRINGBra019847.1-P1e-148(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.12e-85DNA-binding storekeeper protein-related transcriptional regulator