PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676719604
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family LBD
Protein Properties Length: 255aa    MW: 29172.8 Da    PI: 4.5028
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676719604genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26028.64.1e-0914458101
     DUF260  58 msslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                m+s+++++ +r ++Pv+G++gv ++lq  +  +++el++++++l
  676719604   1 MKSIIFQSYVREKNPVHGCLGVTQHLQYMIWLAEEELKAVNSQL 44 
                89************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031952.2E-5141IPR004883Lateral organ boundaries, LOB
PROSITE profilePS508919.721144IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MKSIIFQSYV REKNPVHGCL GVTQHLQYMI WLAEEELKAV NSQLQLYRSQ QNNNNSNGQN  60
HQNGHNQMVG EKQEDVTSQL DLGMGLPVNN NQSFFSPLPV PENQQQPQMS YTYSEVNNHG  120
YSPPAYTESC KEILNNDNAS LAWGQNRFPY HHHNNGFSNE DEHCNEMKNN NGVMAIQSQL  180
VNLQMVSNQQ EEEDDVHEYD EIHQFLKIID DRQSFVDTKE AYASSSGESL KERLDEIGEN  240
ELRNAATCFS LTSVN
Cis-element ? help Back to Top
SourceLink
PlantRegMap676719604
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591366.11e-130PREDICTED: LOB domain-containing protein 27-like isoform X2
SwissprotQ9STS65e-76LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A3N6PMZ11e-131A0A3N6PMZ1_BRACR; Uncharacterized protein
STRINGBo1g072490.11e-129(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-76LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]