PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676717450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family CO-like
Protein Properties Length: 423aa    MW: 47517.9 Da    PI: 4.798
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676717450genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.41.5e-081356340
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
               +r C+ + + +++++C  ++ +lC++C +  H+       H++v
  676717450 13 ARACDSCVKRRARWYCAADDAFLCQSCDTLVHSAnplarrHERV 56
               578*****************************657888888876 PP

2CCT68.12.4e-23365408144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  676717450 365 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 408
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.8221158IPR000315B-box-type zinc finger
SMARTSM003364.2E-101158IPR000315B-box-type zinc finger
PfamPF006431.5E-71356IPR000315B-box-type zinc finger
CDDcd000216.39E-101458No hitNo description
PfamPF062037.1E-18365407IPR010402CCT domain
PROSITE profilePS5101716.083365407IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MKSLANAVGA KTARACDSCV KRRARWYCAA DDAFLCQSCD TLVHSANPLA RRHERVRLKS  60
ASPAASKYSN HSHSASSPPH EAATWHHGFT RKARTPRGSG KKNNSSIFHD LVPEISAEDQ  120
TDSYELEEQL LCQVPVLDPM VAEQFLNDVV EPKIEFPMMR SGVMIDDQED EDNAESCLNG  180
FFPTDMELEE FAADVETLLG HGLSTESYAM EELGLSNTEM LKIEKDETEE EEEGEESKAM  240
NMGICCDDDR DDRDGTVPFE LSFDYESHNT YEEETIMKVE RSSGECIKVK EEEQKTVLML  300
RLNYDSVIST WGGQGTPWTS GEPPERDIDI SDWPVVPMGE NGGESHQKPY VGGFLPSSGF  360
ADGGREARVS RYREKRRTRL FSKKIRYEVR KLNAEKRPRM KGRFVKRASL AVSAANSPLG  420
VNY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1375391RRTRLFSKKIRYEVRKL
Cis-element ? help Back to Top
SourceLink
PlantRegMap676717450
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3529720.0AK352972.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-09-J08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018466779.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
SwissprotQ8RWD00.0COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A1J3JND80.0A0A1J3JND8_NOCCA; Zinc finger protein CONSTANS-LIKE 16
STRINGBra012475.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.10.0B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]